(data stored in SCRATCH3701 zone)

EMBL: CP000435.FABF

CP000435.FABF        Location/Qualifiers
FT   CDS_pept        complement(138921..140168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="sync_0131"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45982"
FT                   /db_xref="GOA:Q0IDV4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV4"
FT                   /protein_id="ABI45982.1"
FT                   /translation="MVEGLQRVVVTGLGAVTPIGNTVADYWEGLTSAKNGVEAITLFDA
FT                   AQHACRFAAEVKNFDPSGFIEPKDAKRWDRFCKFGVVAAKQALTDSGLTITPDNADRIG
FT                   VSIGSGVGGLLTMETQAHVLKDKAPGRVSPFTVPMMIPNMATGLAAIALGAKGPSSAVA
FT                   TACAAGSNAIGDAFQLLQLGKADAMICGGAESAITPLGVAGFASAKALSFRNDDPAGAS
FT                   RPFDKTRDGFVIGEGSGILVLETLAHAEARGATILAEIVGYGTTCDAHHITSPTPGGVG
FT                   GAAAIRLALEDGGIAADSVDYVNAHGTSTPANDSNETAAIKSALGSRAKDIPVSSTKSM
FT                   TGHLLGGSGGIEAVACVLALRNGVVPPTINYNNPDPECDLDVVPNTARELTLGTVLSNS
FT                   FGFGGHNVCLAFRRMS"
     atggtggagg gtctccagcg cgtcgtggtc acaggcctcg gtgccgttac gccgatcggc        60
     aataccgtcg ctgattattg ggagggattg acctctgcaa agaacggcgt cgaagcgatc       120
     accttgtttg atgcagcgca gcacgcctgt cgtttcgctg ctgaagtcaa gaattttgat       180
     cccagtggct tcattgagcc caaagacgcc aaacgctggg atcgtttctg caaattcggc       240
     gtggtagctg cgaagcaagc cctcaccgac tcgggcctca cgatcacccc agacaatgct       300
     gatcgcattg gcgtcagcat cggttctggg gttggtgggc ttctcaccat ggaaacccag       360
     gctcatgtcc tgaaagacaa agccccgggt cgcgtcagcc ccttcacggt gccgatgatg       420
     attccgaata tggccacagg gctggcggcg atcgctcttg gtgccaaagg tcctagctcg       480
     gctgtggcca ccgcctgtgc cgcaggatcc aatgccatcg gcgatgcctt ccagctgctg       540
     cagttaggaa aagccgacgc catgatttgc ggcggtgccg aatcagcgat cacgcccctt       600
     ggggtagccg gcttcgccag tgccaaagcg ctctcgttcc gcaacgatga tcctgctggt       660
     gcgagtaggc ccttcgataa aaccagggat ggattcgtga tcggagaagg ttcagggatt       720
     ttggtccttg aaactcttgc ccacgccgaa gcccgcggag ccacaatttt ggcggaaatc       780
     gttggctacg gcaccacttg tgatgctcac cacatcacct ctccaactcc aggcggcgtt       840
     ggtggtgctg ccgccatccg ccttgctctt gaagatggtg gaatcgctgc tgacagcgtg       900
     gactatgtca acgcccacgg caccagtaca ccagccaacg acagcaacga aaccgcagcg       960
     attaagagtg ctcttggcag tcgcgccaag gacattccgg tgagttcaac gaagtcgatg      1020
     acgggccact tgctcggggg ctcgggcgga atcgaagctg tggcctgtgt gctggcactg      1080
     cgcaacggtg tcgttccacc caccatcaac tacaacaatc cggatcccga atgtgatctg      1140
     gatgttgtgc cgaacacagc acgtgaacta acactgggaa cagtgctgtc caactccttc      1200
     ggcttcggcg gtcacaatgt ctgcctcgcc ttccgacgca tgagctaa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page