(data stored in SCRATCH3701 zone)

EMBL: CP000435.FADD-1

CP000435.FADD-1      Location/Qualifiers
FT   CDS_pept        576167..578065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD-1"
FT                   /locus_tag="sync_0608"
FT                   /product="Long-chain acyl-CoA synthetase"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47818"
FT                   /db_xref="GOA:Q0ICJ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ6"
FT                   /protein_id="ABI47818.1"
FT                   /translation="MKSLARQQHVQGLGRVDQLWPWLEQRHGALMAVDAPHAAHPEHFT
FT                   YQELSQRITTAAAGFRALGIREGDVVGLFAENSPRWLMADQGLMRTGAADAVRGSSAPV
FT                   EELRYILEDAKAVALVVQNADLWQRLQLPAQLRRQLRFVLQLEGDAVDSDVISWDDLLA
FT                   AGAEQQAPDPDLGRDAASAASTTATILYTSGTTGQPKGVPLSHANLLHQMRSLSCVARP
FT                   EPGAPVLSVLPIWHAYERSAEYYFFSCACSQSYTTIKQLKRDLPRVKPVVMVTVPRLWE
FT                   AVQAGFEDVLKTFPASRQRLLRAALSNSSAYCLARRQRCNLMLMPLGRRQRLMACLKSA
FT                   GRWPAHALASKLIWPKLRLQLSGGQLRFPINGGAAIAPHVDSFFEAVGIELLVGYGLTE
FT                   TSPVVSCRRPWRNIRGSSGQPMPQTEFMIVDPESRAPLSFRERGLVLVRGPQVMQGYLG
FT                   KPEATAKVLDVDGWFDTGDLGMLLPDGSVVLTGRAKDTIVLSSGENIEPGPLEAHLLMN
FT                   PVVEQVLLVGQDKKQLAALIVPNQDGLRQFAENKEIENIDLFLPLKDQLKLLDLLKRDF
FT                   NSDLQLRSGSRPEERLCGVAFVEPFTIENGLLTQTLKQKRNEICVRDANTVESIYS"
     ttgaaatcac tcgcccgtca gcagcatgtg caaggcctgg ggagagtgga tcagctctgg        60
     ccctggcttg agcaacgtca tggtgcgctc atggctgtgg atgctcccca tgcggctcat       120
     ccggagcatt tcacttatca ggagttgtcg caacggatca cgacagcggc tgcagggttt       180
     cgtgccttgg ggattcgtga aggcgatgtg gtgggactgt ttgcagaaaa cagtccccgc       240
     tggctgatgg cagatcaagg tttgatgcgc acaggtgcgg ctgatgcggt gcgtggctcc       300
     tcagcccccg tagaagagct gcgttacatc cttgaagacg ccaaggccgt ggccctggtg       360
     gtgcaaaacg cggatctttg gcaacggctc caattgcctg cgcagctgcg caggcagctg       420
     cgctttgtcc ttcagctgga gggtgatgct gtggattcag acgtgatctc ttgggatgat       480
     cttttggcgg ctggcgccga gcaacaggct ccggatccag atcttggtcg agatgcagcc       540
     agcgctgcca gcaccacagc caccatcctt tacacctcag gcaccaccgg tcagccgaag       600
     ggcgttccgc tcagccacgc caacctgctg catcagatgc gcagcttgag ttgcgttgct       660
     cggccagaac ctggcgcacc tgtgctcagc gtgttgccga tctggcatgc ctatgaacgc       720
     agtgcggagt attacttctt ctcatgcgcc tgttcgcaga gctacaccac gatcaaacag       780
     ctcaaacgag atctgcccag ggtgaagcct gtggtgatgg tcacggtgcc gcgcctgtgg       840
     gaggcggtgc aagccgggtt tgaagatgtc ttgaaaacat tccctgcatc caggcagcgc       900
     cttttgcgcg cggcactctc caatagcagt gcctattgct tggcccggcg tcagcgttgc       960
     aacctgatgc tgatgccctt gggtcgccgt cagcgcttga tggcgtgtct gaaatccgcc      1020
     gggcgctggc cagcccatgc cctggcatcc aagctgatct ggccaaagct gaggttgcag      1080
     ctcagtgggg gtcagctgcg cttccccatc aatggaggag ctgcgatcgc gcctcatgtg      1140
     gattccttct ttgaggcggt gggtatcgag ttgttggtgg gctatggcct cactgaaacc      1200
     agtccggttg tgagttgccg gcgtccatgg cgcaacattc gtggaagttc agggcagcca      1260
     atgcctcaga ccgaattcat gattgtggat cctgaatccc gagctcctct cagttttcga      1320
     gaacgtggat tggtgcttgt gcgtggacct caggtcatgc agggatactt ggggaaacct      1380
     gaagccactg caaaagttct ggatgttgat ggatggttcg acaccggtga tttgggaatg      1440
     ctgcttccag atggttctgt ggttttaacg ggtagagcga aagacaccat tgttttaagc      1500
     agcggtgaaa atattgagcc agggcctctc gaagcccatc tgctgatgaa tccagtcgtt      1560
     gaacaagtct tacttgttgg gcaagacaaa aagcaacttg ctgccttgat agttccgaat      1620
     caagacggtt tgaggcagtt tgctgaaaac aaagaaatcg aaaatatcga cttgttcttg      1680
     ccactaaaag accaattaaa gttgttagat cttctaaaga gagattttaa ttctgatctt      1740
     caattgcgtt cgggatcaag gccagaagaa aggctatgtg gtgttgcatt tgttgaacct      1800
     tttacgattg aaaatggttt gttgactcaa acactgaagc aaaaaagaaa tgagatttgt      1860
     gtcagagacg cgaatactgt tgagagtatt tacagttag                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page