(data stored in SCRATCH3701 zone)

EMBL: CP000435.FTSY

CP000435.FTSY        Location/Qualifiers
FT   CDS_pept        12600..14255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="sync_0011"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47633"
FT                   /db_xref="GOA:Q0IE72"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE72"
FT                   /protein_id="ABI47633.1"
FT                   /translation="MVYDWFNRGSVPPETPADPLVDPEVQSDQSSAPQPSATEPSGTQP
FT                   ADVQASEPQSTESEDDSLEWARQAYARLKAQKAQAAEAAKTVQDDSTSVQNVVVPPVME
FT                   PPAVVPETVVPSVVSPSEEPPALEAPSVEPAQPAPVVEPAVVPAPTPAASASPATTPTP
FT                   PAPALSFLEQAAAQRDQRQQELEQPAEPNPVPVVPADAQDAPNIDEDEPSLGDFDDAFT
FT                   WSAEVLAAQGRSAEQVTLEEIDWLGRLRQGLEKTRQGFVTGLLENLGDDPLTPEVLDDL
FT                   ESLLLRADAGVQATDQVLDALRQRMNEQVVDPSEGIRFLKEQLRDLLDEPIKSSAVEVL
FT                   APQRDRLNVWLLVGVNGVGKTTTLGKLANLAVRSGYSALIAAADTFRAAAVQQVQVWGD
FT                   RSDVPVVANPSANADPAAVVFDAIGAARSKGTDLVLVDTAGRLQTKHNLMEELEKIRRV
FT                   VDRLAPEAHVESLLVLDASQGQNGLKQAMAFARAAGLTGVVITKLDGTARGGVALAVAS
FT                   EAKLPIRFIGAGEGIRDLRPFNSFEFVEALLASR"
     atggtctacg actggtttaa tcgcggatcc gttcctcctg aaaccccagc tgacccacta        60
     gttgatccag aggtccaatc cgatcagtct tctgcgccgc aaccatctgc gactgaacct       120
     tctggaaccc aaccagcaga cgtgcaagcg tcggaacccc aatcgactga gtcggaagac       180
     gattctcttg agtgggcacg ccaggcttat gcacgtttaa aagcccagaa agctcaggct       240
     gctgaggcgg ccaagacggt tcaggatgat tccacatctg tacagaacgt ggttgtgcct       300
     ccagtcatgg agcctccagc ggtcgtgcca gaaaccgttg tcccttctgt tgtttctccc       360
     tcagaagaac ctcctgcact cgaagctccc tcagtcgagc ctgcacaacc ggcccctgtt       420
     gtggagcctg ctgttgttcc cgctcccact cccgcagcat ctgcttctcc tgccacaact       480
     cctacacctc ccgctccggc gctgtctttt cttgaacagg cagctgccca gcgggatcag       540
     cgtcagcagg agctagagca acctgctgag ccaaatcctg ttcccgttgt tccagccgat       600
     gctcaagacg ctccgaacat tgatgaggac gaacccagcc tcggagactt cgacgatgca       660
     ttcacctggt cggctgaagt tttagcggcc caagggcgga gcgccgagca ggtcaccctc       720
     gaggagatcg attggttagg gcgacttcga caaggcctgg agaaaacccg ccaagggttc       780
     gtgaccggtc tgctggagaa cctgggcgac gatccgttga cgccagaggt gctcgacgat       840
     ctcgaatcgc ttttgttgag agctgatgcg ggcgttcagg ccacggatca ggtgctggat       900
     gccttgaggc agcggatgaa cgaacaggtt gtcgatccga gtgaaggcat tcgtttcctg       960
     aaggaacagc ttcgtgacct tctcgatgag ccgattaagt ccagtgctgt tgaggtcctc      1020
     gctcctcaaa gggatcgctt gaatgtttgg cttttggttg gtgtgaatgg cgtcggtaaa      1080
     accacaaccc tcggcaagct cgccaatctt gccgtccgca gtggttattc cgctttgatt      1140
     gcagcggctg acaccttccg tgctgctgct gttcagcaag tgcaggtttg gggagatcgc      1200
     agtgatgtgc cagttgtggc caatccctca gcgaatgcgg atcctgcagc agtggtgttt      1260
     gatgccatcg gcgccgcccg ttcgaaaggc actgatttgg ttctggtaga tacggctggt      1320
     cgcctacaga ccaagcacaa cttgatggaa gagcttgaaa agatccgccg tgtggtggat      1380
     cgtcttgctc ccgaagccca tgtggaatcg ctgttggtgc ttgatgccag tcagggtcag      1440
     aacggcttga agcaggcaat ggcgtttgcc cgcgcagctg ggcttacagg tgtggtgatc      1500
     accaagcttg atggcacagc cagaggtggt gtggcactgg ctgttgcctc agaagcaaag      1560
     ttgccgattc gctttattgg agctggtgag ggaattcgag accttcgtcc cttcaatagt      1620
     tttgagtttg tggaggccct cttggcatcg cgttga                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page