(data stored in SCRATCH3701 zone)

EMBL: CP000435.FUSA

CP000435.FUSA        Location/Qualifiers
FT   CDS_pept        complement(387580..389655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="sync_0382"
FT                   /product="translation elongation factor G"
FT                   /note="identified by similarity to SP:P80868; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03144; match to
FT                   protein family HMM PF03764; match to protein family HMM
FT                   TIGR00231; match to protein family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47418"
FT                   /db_xref="GOA:Q0ID58"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID58"
FT                   /protein_id="ABI47418.1"
FT                   /translation="MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHD
FT                   GAAVTDWMAQERERGITITAAAISTSWNNHRINIIDTPGHVDFTIEVERSMRVLDGVIA
FT                   VFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVFGQIKDRLKANAVPIQ
FT                   LPIGAEGELSGIIDLVENKAHIYKDDLGQDIEVTDVPADMKDEADKWRNVLMETIAEND
FT                   EDLIEKFLESGELSNSDLKRGIRTGVLKHNLVPVLCGSAFKNKGVQLVLDAVVDYLPAP
FT                   IDVPPIQGLLPNGKEAVRPSDDNAPFSALAFKVMADPYGKLTFVRMYSGVLEKGSYVLN
FT                   STKDTKERISRLVVLKADDREEVDALRAGDLGAVLGLKNTTTGDTLCATDDPIVLETLF
FT                   VPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVRTDQETGQTVIAGMGELHLEIL
FT                   VDRMLREFKVEANIGAPQVSYRETIRGSSKGEGKFSRQTGGKGQYGHVVIEMEPGEPES
FT                   GFEFINKIVGGIVPKEYIKPAEQGMKETCESGVIAGYPLIDVKCTMVDGSYHDVDSSEM
FT                   AFKIAGSMAFKDAVKKCNPVLLEPMMKVEVEIPEDFLGSVIGDLSSRRGQVEGQSVDDG
FT                   TSKVSSKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIISKNQGNS"
     gtggcacgcg actttcccct ggaacgcgtc agaaatattg gtattgcagc ccatattgac        60
     gctggtaaaa caaccaccac tgagaggatt ctgttctact ccggtgtcgt gcacaagatt       120
     ggagaggtgc atgacggtgc agccgtaacc gattggatgg cccaagagcg cgagcgtggg       180
     atcacgatta ctgccgctgc tatttccaca agctggaata atcaccggat taatattatt       240
     gatactcctg gtcacgttga cttcaccatc gaagttgaac gctccatgcg cgtgctcgac       300
     ggagtgatcg cagtcttttg cgctgtgggt ggcgtgcaac ctcaatctga gacggtgtgg       360
     cgccaagccg accgttattc cgtgccacgg atggtgttcg tcaacaagat ggaccgcact       420
     ggtgccgatt tcctaaaagt ttttggtcaa atcaaggatc gcctcaaagc caatgctgta       480
     cccatccagc ttccgattgg agccgaaggc gaactcagtg gaatcatcga tcttgttgaa       540
     aacaaagctc atatttataa agatgattta ggtcaagaca tcgaagtcac cgatgttccg       600
     gccgacatga aagacgaggc agataagtgg cgcaacgttt tgatggaaac gatcgctgaa       660
     aacgatgaag atctcatcga gaagttcctg gaatcaggtg aactttctaa ttccgatctg       720
     aagcgaggta ttcgtacagg ggttcttaag cacaatctag ttccggtact ctgcggctca       780
     gcctttaaaa acaaaggcgt gcaacttgtt ctcgatgctg ttgttgatta tcttccagcg       840
     ccgattgatg ttccaccaat tcaaggcctt cttccaaacg gaaaagaagc tgttcgtccg       900
     tccgatgaca acgcaccctt cagtgctctg gccttcaagg tgatggccga tccttatggg       960
     aagctcacct ttgttcgtat gtattcaggt gtccttgaaa agggaagcta tgtcttgaat      1020
     tcgacgaaag ataccaagga gcgtatttct cgcctggtcg tgctgaaagc cgatgatcgc      1080
     gaagaagttg atgcactacg ggccggcgat ctaggtgcag ttcttggtct taagaacaca      1140
     acgactggag acaccctctg cgcaacagac gatccgattg ttctggaaac tctgtttgtt      1200
     cctgagcccg ttatctcagt tgcggtagag cccaaaacca aaggagatat ggagaaactc      1260
     tccaaggctc tggtgtcttt ggccgaagaa gaccccacct tccgcgttcg cacggaccag      1320
     gaaaccggac agaccgtgat tgcgggtatg ggcgaactcc acctcgaaat cctggtggat      1380
     cgcatgctgc gtgaattcaa agtggaagcc aatattggtg ctcctcaggt gtcctaccga      1440
     gaaaccattc gtggttcctc caaaggagaa gggaagttct caaggcaaac cggtggtaaa      1500
     ggccaatacg gtcatgttgt tatcgagatg gagcctggcg agcctgaatc tggctttgaa      1560
     ttcatcaaca aaattgttgg cggcatcgtt cccaaggaat acatcaagcc agccgagcaa      1620
     ggcatgaagg agacctgcga gtcaggtgtg attgccggtt atccactcat tgatgtcaaa      1680
     tgcacgatgg tcgatgggtc ctatcacgat gtggactcgt cggagatggc ttttaagatt      1740
     gctggctcca tggccttcaa ggacgcggtc aagaagtgca atcctgtgct tcttgagccg      1800
     atgatgaagg tcgaagtcga aatccccgag gatttcctcg gttcggtgat cggcgacctg      1860
     tcttcccgcc ggggacaggt agagggccaa tccgtcgacg acggaacgtc taaagtctcc      1920
     tccaaggtgc ccttggccga gatgttcggc tacgccaccg aactccgatc catgacccag      1980
     ggtcggggta ttttctcgat ggaattcagt cactacgagg atgttcctcg caatgtggcc      2040
     gaggccatca tctccaagaa tcagggcaat tcctga                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page