(data stored in SCRATCH3701 zone)

EMBL: CP000435.GALE

CP000435.GALE        Location/Qualifiers
FT   CDS_pept        complement(243244..244356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="sync_0231"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993; match to protein family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46851"
FT                   /db_xref="GOA:Q0IDK5"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK5"
FT                   /protein_id="ABI46851.1"
FT                   /translation="MAQLLITGGAGFIGSHTCLVLLEAGHQLLVLDDFSNSSAIALERV
FT                   AELAGARLQRDQPTLRAAPETLTLVEGDIRDAQCLDALFTSTKTFDQPIEAVIHFAGLK
FT                   AVGESVQQPLRYWDVNVVGSQRLLSAMDRHSCRTLVFSSSATLYGYPDQVPIPETAPIQ
FT                   PINPYGASKQAAEALFADIAGCSGKPEPIQASQGGWRIARLRYFNPVGAHPSGRIGEDP
FT                   NGIPNNLFPFITQVAIGRRPELTVFGDDWPTPDGTGVRDYIHVMDLAEGHREALHSLLN
FT                   TDPQLLTLNLGSGQGASVLDVVKAMEAASQRAIPYRIAPRRPGDAALTVANPTLAAQHL
FT                   HWRTQRSLAEICRDGWAWQQANPQGYIRQT"
     atggctcagc tgctgattac gggcggagcc ggctttatcg gcagccatac ctgccttgtg        60
     ctgctggagg ctggccatca actgttggtg ctggacgatt tcagcaacag ctcagcgatc       120
     gccctggaac gggtcgctga actcgcaggc gcccgcttgc agcgagatca accaaccctg       180
     cgagcagcac cggaaacgtt gacccttgtg gagggagata tcagggacgc ccaatgcctg       240
     gatgccctgt tcacaagcac aaaaacgttc gaccagccga ttgaggcggt gattcatttc       300
     gctggactaa aggctgtggg tgaatcggtt caacagcctt tgcgctactg ggatgtgaac       360
     gttgttggct ctcagagact gctgagtgcg atggaccgcc acagctgccg caccctggtg       420
     ttcagcagta gcgcaaccct ttacggctac ccggatcaag tgccgattcc ggaaacggct       480
     ccgatccaac cgatcaatcc ctacggagcc agcaaacaag ccgcggaagc cctatttgcc       540
     gacatagcag gctgcagcgg caaacccgaa ccgatccaag ccagccaggg tggctggcgc       600
     attgcaaggt tgcgctattt caatcccgta ggcgcccacc ccagtggccg gattggggaa       660
     gaccccaacg gcatccccaa caatctgttc ccctttatta cgcaggtggc cataggccgc       720
     cggcctgaac tcaccgtgtt tggtgacgac tggcccacgc cggatggaac cggagtccgc       780
     gactacatcc acgtgatgga tctagccgaa ggtcaccgag aagcactcca ttcgctgctc       840
     aacactgatc cccaattgct caccctcaat ctggggagcg ggcagggagc gagcgtgctg       900
     gatgtggtga aggctatgga agcggcgagc cagcgtgcga ttccttatcg aatcgctccc       960
     aggcgtcctg gcgatgccgc cctcaccgtg gccaatccaa ctctggcggc ccaacacctc      1020
     cattggcgca cgcagcgctc gctcgccgag atctgccgtg atggctgggc ttggcaacag      1080
     gccaatccgc agggctacat ccgccaaaca tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page