(data stored in SCRATCH3701 zone)

EMBL: CP000435.GUAA

CP000435.GUAA        Location/Qualifiers
FT   CDS_pept        48046..49632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="sync_0047"
FT                   /product="GMP synthase, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47248"
FT                   /db_xref="GOA:Q0IE37"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE37"
FT                   /protein_id="ABI47248.1"
FT                   /translation="MSSVQSEGQRKPAIVILDFGSQYSELIARRVRETEVFSVVLGYST
FT                   SAEELRALAPRGIILSGGPSSVYADEAPLCDPAIWDLGVPVLGVCYGMQLMVQQLGGQV
FT                   VAATGKAEYGKAPLKVDDPTALLTNVESGSTMWMSHGDSVEALPDGFLRLAHTANTPEA
FT                   AIANHKRRLYGVQFHPEVVHSTGGMVMIRNFVYHICGCEPDWTTEAFIDEAVANVRDQV
FT                   GQKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMEFFDRKFNIH
FT                   VEYINARERFIKKLDGITDPEEKRKIIGTEFIRVFEEESRRLGPFDYLVQGTLYPDVIE
FT                   SAGTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRTLGLPEE
FT                   IVSRHPFPGPGLAIRILGEVTEEKLDCLRDADLIVREEVNAAGLYHDIWQAFAVLLPVR
FT                   SVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMEVISNRIVNEVKGVNRVVMDI
FT                   TSKPPGTIEWE"
     atgtcatcag tccagagcga aggtcagcgc aaaccggcca tcgtcattct tgatttcggt        60
     tcccagtact cggaactgat tgcacgccgc gttcgtgaga cggaggtgtt ttcggtggtg       120
     ttgggctaca gcaccagcgc tgaagaatta cgggccttgg ctccgcgtgg aatcatcctc       180
     agcggaggcc caagttcggt ttatgccgat gaggctcccc tctgcgatcc agcgatttgg       240
     gatctgggcg tccctgtgct gggggtctgc tacggcatgc agttgatggt tcagcagctt       300
     ggtggtcagg tggtcgcggc tacgggtaag gctgaatacg gcaaggctcc gctcaaggtg       360
     gatgacccca ctgcacttct cacgaatgtt gagagtggct ccacgatgtg gatgagtcac       420
     ggtgattccg tggaggcttt gcccgacggc ttcctgcgtt tggctcatac agcgaatacg       480
     cctgaggcgg ctatcgcgaa tcacaagcga cgcttatacg gcgttcaatt tcaccctgag       540
     gtggttcatt ccactggtgg aatggtgatg attcgcaatt ttgtgtatca catctgtggt       600
     tgtgaaccgg attggaccac tgaggctttt atcgatgaag cagtggcaaa tgtgcgtgat       660
     caagttggtc aaaagagagt gctgcttgct ctctcaggag gcgtggattc ttcaaccctt       720
     gcttttttat tgaagaaagc gattggagat caacttacct gcatgtttat tgatcaaggc       780
     ttcatgcgta aaggcgaacc tgaattcctg atggagttct ttgatcgtaa atttaatatt       840
     catgttgagt atatcaatgc tcgtgaacgg tttatcaaaa agcttgatgg cattacggat       900
     ccagaagaga agcgcaaaat cattggcacg gaattcatcc gtgtgtttga agaagagagt       960
     cgccgtctag gcccatttga ttatttagtc cagggcacgc tttatccgga tgtgattgaa      1020
     agtgctggca ccaacgtgga tcccaaaacc ggggagcgtg tggctgtgaa gatcaagagc      1080
     catcacaacg tgggaggtct tcctaaggat ctgcgcttca agttggtgga gcccctacgc      1140
     aagctgttta aggatgaagt tcgtaaggtt ggtcgaacgc ttgggttgcc cgaggagatc      1200
     gtgagtcgcc atccattccc aggccctgga ctagcgattc gcatcttggg cgaagtcacg      1260
     gaggaaaagc tcgattgttt gcgtgatgca gatctgattg tgcgcgagga agtgaacgca      1320
     gcggggctct atcacgacat ttggcaggcg tttgcggtgc ttcttcccgt gcgctcagtg      1380
     ggtgtgatgg gtgataagcg cacttatgcc tggccgatcg tgctgcgctg tgtatcgagt      1440
     gaggacggca tgaccgctga ttggtcgagg cttccttatg accttatgga agtgatttcc      1500
     aatcggattg tgaatgaggt gaaaggagtg aatcgcgtgg taatggacat cactagcaag      1560
     cctccaggaa cgattgagtg ggaatag                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page