(data stored in SCRATCH3701 zone)

EMBL: CP000435.HISH-1

CP000435.HISH-1      Location/Qualifiers
FT   CDS_pept        complement(181940..182575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH-1"
FT                   /locus_tag="sync_0172"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47087"
FT                   /db_xref="GOA:Q0IDR3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR3"
FT                   /protein_id="ABI47087.1"
FT                   /translation="MKPSTCVVIDYGLGNIFSVLNALKAQGVDACLTSDRHLIQSADRV
FT                   ILPGVGAFGRAAQRLRELHLDEALKCFTGTGRPFLGICVGMQLLMTTSREFGEHDGLNL
FT                   IPGVVARISEHMNADNSMRIPIIGWHKVTGHKANLNSLAQNLDGSAYYFVHSYACQPLD
FT                   TSVVTSTVSHSETVVVSSIQHENIMGVQFHPERSSFAGQSLLSKFLSL"
     atgaagccat caacatgtgt tgttattgat tatggtcttg gaaatatttt ttcagtacta        60
     aatgctctca aagctcaggg ggtagatgct tgccttacat cagatagaca tttaattcaa       120
     tcagcggaca gagtaattct tccgggcgtt ggagcatttg gtcgggctgc gcagagactt       180
     cgcgaactgc atttggatga agctctcaaa tgcttcactg gtacggggcg tcctttttta       240
     ggtatatgcg taggaatgca actattaatg actacaagcc gagaatttgg agagcacgac       300
     ggacttaacc ttattccggg agtagtggcc agaatctctg aacatatgaa tgcagataat       360
     tcgatgagaa taccaattat aggatggcac aaagtaaccg gtcataaagc caacttaaat       420
     tccttagctc agaacttaga tggatctgca tactattttg ttcattctta tgcttgccaa       480
     cctcttgaca catctgtggt gacaagcaca gtttcacata gtgagactgt agttgtatct       540
     tcaattcagc atgaaaacat tatgggtgtt caatttcatc cggaacgctc atcatttgcc       600
     gggcaatctc tgttaagcaa attcttatct ttataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page