(data stored in SCRATCH3701 zone)

EMBL: CP000435.HISS

CP000435.HISS        Location/Qualifiers
FT   CDS_pept        244447..245733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="sync_0232"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47698"
FT                   /db_xref="GOA:Q0IDK4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDK4"
FT                   /protein_id="ABI47698.1"
FT                   /translation="MSQLQTLRGMVDLLPEQTRRWQAVESVAREHFRCAGLDEIRTPLL
FT                   EFTDLFARGIGEGTDVVGKEMYTFLDRGDRSCTLRPEGTASVVRAALQHGLLSQGAQRL
FT                   WYGGPMFRYERPQAGRQRQFHQIGVEFLGASSPRSDAEVIALAWDLLTDLGIQGLNLEI
FT                   NSLGTPDDRQRFRSELVQWLEERVEQLDAESQARLTTNPLRILDSKDKGTQQLLNDAPT
FT                   LLKALSKESVDRFEQVCALLTALQIPYQLNPRLVRGLDYYGHTAFEITSDQLGAQATVC
FT                   GGGRYDGLIQQLGGPVTPAIGWALGMERLLLVISAAAQADPDGAAARLTATPSPLVYVI
FT                   NRGEQAEPQALSLARQWRGAGLAVELDGSSASFGKQFKRADRSGAPWAVVLGDEEASAG
FT                   QVRLKPLRGEGEEKQLTWEDALSYLMKQR"
     gtgagtcagc tgcagacttt gcgcggaatg gtggatctgc tgccggagca gacacgacgt        60
     tggcaggctg ttgagtcggt ggcgcgcgaa cattttcgct gcgcgggttt agacgagatt       120
     cgaacgccgt tgctcgaatt cacggatctg ttcgcccggg gcattggtga gggaacggat       180
     gtggtgggta aggagatgta taccttcttg gatcgtggcg accgctcttg caccctgcgt       240
     ccagaaggca ccgcctctgt ggtgagagca gccctgcaac atggcttgct cagccaggga       300
     gctcagcggc tgtggtacgg cggcccgatg ttccgctatg aacgtcctca ggctggccgt       360
     cagcgacagt ttcaccagat cggtgttgaa tttctcgggg ccagcagtcc gcgaagcgat       420
     gctgaggtga ttgccctggc ctgggatttg ttgactgact tgggaattca gggcctcaat       480
     cttgaaatca acagcctggg cactccagat gatcgccagc ggtttcgctc tgagcttgtg       540
     cagtggcttg aggagcgcgt tgagcagttg gatgcagagt cccaagcgcg tctcaccacg       600
     aaccccctgc gcattcttga cagcaaagac aagggcaccc agcagctgct gaatgatgcg       660
     ccaacgttgt tgaaggcact cagtaaggag agtgtggatc ggtttgagca ggtgtgtgcc       720
     ctgctgaccg cgctgcagat tccctatcaa ctcaatcctc gcttggtgcg cggtctcgat       780
     tactacggcc acactgcctt tgaaatcacc agcgatcaac ttggtgccca ggccacggtc       840
     tgtggcggtg gtcgttacga cggtctgatc cagcaattgg gtggtccagt tacgcccgcg       900
     atcggctggg cattagggat ggaacgtctg ttgctggtga tctccgctgc tgcgcaagcc       960
     gatcccgatg gagctgcggc acggctcact gcgacgccat caccgctggt ctacgtgatc      1020
     aatcgcggcg agcaggctga accgcaagcg ttgagcttgg cccggcaatg gcggggggca      1080
     ggccttgccg ttgagctgga tggctcgagc gcgtcgttcg gcaagcagtt caagcgtgcc      1140
     gatcgttccg gtgcgccatg ggctgtggtg cttggcgacg aagaggcttc ggccggccag      1200
     gtgcggctga agcccttgcg tggtgagggg gaggaaaagc aactcacctg ggaggacgcg      1260
     ctgtcttacc tcatgaaaca gcgataa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page