(data stored in SCRATCH3701 zone)

EMBL: CP000435.ILES

CP000435.ILES        Location/Qualifiers
FT   CDS_pept        complement(340540..343446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="sync_0333"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45549"
FT                   /db_xref="GOA:Q0IDA5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDA5"
FT                   /protein_id="ABI45549.1"
FT                   /translation="MTQQTGQDADQRPSYKDTLNLLETGFGMRANAIHREPELQAFWKE
FT                   KGIDLDLGRNNPGPVFTLHDGPPYANGALHMGHALNKVLKDIINKHRLMQGRKVRFVPG
FT                   WDCHGLPIELKVLQAMNQEQRQALTPIKLRKKAAAYAHKQVAGQRAGFQRWGIWADWDH
FT                   PYLTLQKDYEAAQIDVFGTMALKGHIYRGLKPVHWSPSSRTALAEAELEYPDGHTSPSV
FT                   YVGFPVVDLPESLRSKLNAQGLDVPAASDTLSQCLQVAIWTTTPWTLPANLAVSVNDRL
FT                   DYCLADDGNGQLLIVAAELCDSIASKLERPLQAKATVKGADLAGITYSHPLLERRSAIV
FT                   VGGEYITTESGTGLVHTAPGHGVDDFNTGRKHGLPVLCPVDEAGTLTAEAGPFEGLNVL
FT                   KDANAKIIAALEDSGSLLLQESYSHRYPYDWRTKKPTIFRATEQWFASVEGFRTEALTA
FT                   IDGVQWLPASGRNRIESMVSERGDWCISRQRTWGVPIPVFYQRETGEVLLNSDSIAHVK
FT                   ALIAEHGADIWWEKDEVDLLPSSHKAEAHLWRKGTDTMDVWFDSGSSWASVSSQRDGLS
FT                   YPADLYLEGSDQHRGWFQSSLLTSVAVNGTAPYRTVLTHGFALDEKGRKMSKSLGNVVD
FT                   PMVIIEGGKNQKQEPAYGADVLRLWVSSVDYSADVPIGAGILRQLSDVYRKVRNTSRYL
FT                   LGNLHDFIPSRDAISISDLPLLDRWMLQRTATVLDQISEAFERYEFFRFFQLLQNFCVA
FT                   DLSNFYLDIAKDRLYVSAPNDKRRRSCQTVMALIIERLAAAIAPVLCHMAEDIWQNIPY
FT                   PTGTESVFLSGWPSVPEEWRDDSLRDPMQELRELRAAVNKVLEECRSKRKLGSSLEAAV
FT                   RLEARTPALQDALQWLQSKGDQEVDGLRDWLLVSQLQIGGEPWAELLASDDNELAVIEV
FT                   ALSRGQKCERCWHYEADIGQYSDHPGLCGRCVSVLERR"
     gtgacccagc agacaggcca ggacgctgat cagcgcccgt cctacaaaga caccctcaac        60
     ctgctggaga cggggtttgg catgcgtgcc aatgccatcc accgcgaacc ggaacttcaa       120
     gcgttctgga aagagaaagg cattgatctg gatcttggac gcaacaatcc cggcccggtg       180
     ttcaccctgc atgacggccc cccttatgcc aacggcgccc tgcacatggg ccacgccttg       240
     aacaaggtgc tcaaggacat catcaataag catcgactga tgcaaggcag gaaggtgcgt       300
     ttcgtgcctg gctgggactg ccatggccta ccgattgagc tcaaagtgct ccaggccatg       360
     aaccaggagc agcgtcaagc gctcaccccg atcaagttgc gcaaaaaggc tgcggcctac       420
     gcccacaagc aggttgcagg acaaagggcg ggctttcagc gctggggcat ctgggccgac       480
     tgggatcatc cctatctgac gcttcaaaag gactacgaag ccgctcagat cgacgttttt       540
     ggaacgatgg cgctgaaggg ccatatttac cgaggcctga agccagtgca ctggagccct       600
     agctcacgca ccgcactagc agaagccgaa ctggaatatc ccgatggaca caccagcccc       660
     agtgtctacg tgggctttcc tgttgttgat cttcccgaaa gcctacgtag caagctcaac       720
     gcgcagggct tggacgtacc cgcagcgagc gacaccctga gtcagtgcct acaggtagcg       780
     atctggacga ctaccccctg gactctgccc gccaacctgg cggtgtcggt gaacgatcgc       840
     ctcgattact gcctcgcaga tgacggcaac gggcagcttc tgatcgtggc agccgagctt       900
     tgcgactcca tcgcctccaa gctggaacgc ccactgcaag ccaaagccac cgtgaagggg       960
     gccgatcttg ctggcatcac ctacagccac cccctgctcg agcgccgtag cgccattgtt      1020
     gtaggtgggg agtacatcac cacggaatcg ggtacgggtc tggtgcacac ggcaccaggc      1080
     catggcgtgg atgacttcaa caccgggcga aagcacggcc tgcccgtgct ctgccctgtg      1140
     gatgaagccg gaacactcac cgcagaagcc ggcccattcg agggcttaaa cgtgctcaag      1200
     gatgccaatg caaagatcat cgcggcgctc gaagactccg gctccctact cctccaagag      1260
     agctacagcc atcgctatcc ctatgactgg cgcacgaaaa agcccacgat cttcagagcg      1320
     acagaacagt ggtttgcctc agtagaagga ttccgcaccg aggcgctaac ggccattgat      1380
     ggcgtgcaat ggctgcccgc atccggcagg aacaggattg aatccatggt gtccgagagg      1440
     ggcgactggt gcatttcccg tcaacggacc tggggtgtcc cgattcccgt gttctaccaa      1500
     cgtgaaaccg gcgaagtgct gctcaattcc gactccatcg cccatgtcaa agctctgatc      1560
     gcagaacacg gagccgacat ttggtgggaa aaagacgagg ttgacctcct cccctccagc      1620
     cacaaagcag aagcgcacct ctggcgcaag ggcaccgaca ccatggatgt gtggttcgat      1680
     tccggctcaa gctgggcctc tgtgtcgagc caacgcgacg gtctcagcta cccagcagat      1740
     ctgtacttag aaggatctga tcagcatcgc ggctggttcc agtcctcatt gttgacctcg      1800
     gtggccgtca acggcacagc gccctatcga accgtgctta cccatggttt tgccttggat      1860
     gaaaaaggca gaaagatgag caaatcactc ggcaatgttg ttgacccgat ggtgatcatc      1920
     gaaggcggca aaaaccaaaa gcaagaaccg gcctacggcg ccgatgtgct tcgcctatgg      1980
     gtgagttctg tggactattc cgcagacgtg ccgatcggtg ctggcatcct gcggcagcta      2040
     tcagacgttt atcgcaaggt gcgcaacacc tcgcgctacc tgcttggaaa tctccacgac      2100
     ttcatcccaa gccgtgatgc gatctccatc agcgatttgc cgttgctcga tcgctggatg      2160
     ttgcagcgca ccgcaaccgt gctcgaccag atcagtgaag cgtttgaacg ctatgaattc      2220
     ttccgcttct tccagctcct gcagaacttc tgcgttgccg atctttcaaa cttctatctc      2280
     gacatcgcca aggaccggct gtacgtcagc gcccccaacg acaagcgtcg ccgcagctgc      2340
     caaaccgtga tggcgctgat catcgaacgt ctggccgcgg ccatcgcccc agtgctttgc      2400
     catatggcag aagacatctg gcaaaacatt ccctatccca cagggaccga gtcggtgttt      2460
     ctcagcggct ggcccagcgt gccggaggag tggcgcgatg acagccttcg agaccccatg      2520
     caagagcttc gcgagctgcg cgcagcggtt aacaaagtgc tggaagaatg ccgaagcaag      2580
     cgcaagctgg gatcatcgct tgaagcggcc gttcgcctcg aagcgcgcac ccccgctctc      2640
     caagacgccc ttcaatggct ccaaagcaaa ggagatcaag aggtggatgg cctgcgcgac      2700
     tggctcctcg tgtcccaatt gcagattgga ggcgagcctt gggccgaatt gctggccagt      2760
     gatgacaacg agctcgccgt gatcgaagtg gccctatctc ggggtcagaa gtgtgagcgc      2820
     tgttggcact atgaagccga catcggtcaa tacagtgatc accccggctt gtgtggtcgc      2880
     tgcgtgtccg tgctggaacg gcgctga                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page