(data stored in SCRATCH3701 zone)

EMBL: CP000435.ISPH

CP000435.ISPH        Location/Qualifiers
FT   CDS_pept        complement(302352..303548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="sync_0292"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to protein family HMM PF02401;
FT                   match to protein family HMM TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45510"
FT                   /db_xref="GOA:Q0IDE5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDE5"
FT                   /protein_id="ABI45510.1"
FT                   /translation="MDTHAFKRSLHHSDRYNRRGFGRADEVAGSLEQAYQSSLIGSIRD
FT                   NGYSLTHGRLKVRLAEAFGFCWGVERAVAMAYETRRHYPQERIWITNEIIHNPSVNDHL
FT                   REMDVLFISVEGGVKDFSGVATGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKV
FT                   WTTVEKHKKQSFTSIIHGKVKHEETLATSSFAGTYLVVLDLEEARLVADYILGKGNRES
FT                   FMERFSKACSPGFDPDRDLEHLGVANQTTMLKSETEEIGRLFERTMLSKYGPTDLNEHF
FT                   LAFNTICDATQERQDAMFSLVDETVDLMVVIGGYNSSNTTHLQEIAVSRGIRSFHIDTP
FT                   ERIHTDNSIEHKPLGEELTVEELFLPSGPVTVGITSGASTPDRVVEHVIQRLIALSEN"
     atggatactc acgccttcaa acgctccctt catcactccg atcgctacaa ccggcgaggc        60
     ttcggtcgag ctgacgaggt ggctggcagt ctggaacagg cgtaccaaag cagcctgatt       120
     ggttccatcc gagacaacgg gtacagcctg acccatggcc gactcaaggt gcgcctcgcc       180
     gaagcgtttg gattttgctg gggagtggaa agggctgtcg ccatggctta cgagacgcga       240
     cgtcactacc cgcaagaacg catctggatc accaacgaaa tcatccataa cccctcagtg       300
     aatgaccacc taagagaaat ggacgtgttg ttcatctccg tggagggtgg agtgaaggac       360
     ttttcgggcg tggcaacggg cgatgtggtg atccttcccg cttttggcgc caccgttcaa       420
     gagatgcaac tgctcaatga gcgtggctgt cacattgttg acaccacctg tccatgggtt       480
     tcaaaggtgt ggacgacggt tgagaagcac aagaagcaat ccttcacgtc gatcattcac       540
     ggcaaggtga aacatgaaga gacgcttgca accagctcct ttgccggaac gtatctcgtc       600
     gttctcgatc ttgaggaagc ccggcttgtc gctgattaca ttctcggcaa aggcaatcgt       660
     gaatcattta tggaacggtt ctccaaggcc tgttctccag gatttgaccc cgatcgcgat       720
     ctcgaacatt tgggtgtggc caaccaaacc accatgctca aaagtgaaac tgaagaaatt       780
     ggacgcttgt ttgagcgcac catgctcagc aaatacgggc caacggatct caatgagcat       840
     tttttagcgt tcaacaccat ctgcgacgcc acccaggagc ggcaggacgc catgttctcg       900
     ctcgttgacg aaactgtgga tctaatggtg gtgattgggg gctacaactc ctccaacacc       960
     acccatctgc aagaaattgc agtcagccgc gggatccgtt ccttccacat cgacactcca      1020
     gaacgaatcc acaccgacaa ctcgatcgag cacaagcccc ttggcgaaga gctcacagtc      1080
     gaagagttat tcctgcccag tgggcccgta accgtaggga tcacctcagg ggcctccacc      1140
     ccagatcgag ttgtggagca tgtcatccag agactgatcg ccctgagcga aaactga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page