(data stored in SCRATCH3701 zone)

EMBL: CP000435.LIPA-1

CP000435.LIPA-1      Location/Qualifiers
FT   CDS_pept        complement(397849..398727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA-1"
FT                   /locus_tag="sync_0389"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47455"
FT                   /db_xref="GOA:Q0ID51"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID51"
FT                   /protein_id="ABI47455.1"
FT                   /translation="MTSIQKPDWLRVKAPQRERIGEVADLLLDLKLNTVCQEASCPNIG
FT                   ECFAGGTATFLIMGPGCTRACPYCDIDFDKSVRALDPTEPQRLGEAVSRLGLKHVVITS
FT                   VNRDDLEDGGASQFVACIEQVKQHSPLTTIELLIPDFCGNWDALATVMEASPHVLNHNI
FT                   ETVPRLYRQARPQGVYERSLELLKRVRDGWSRAYSKSGLMVGLGESDSEVIEVLRDLRE
FT                   HRVDIVTIGQYLSPGPKHLRVDRFVTPEQFESYRLKGEQELGFLQVVSTPLTRSSYHAG
FT                   EVQKLMTIHPR"
     atgacgtcca ttcagaaacc tgactggttg cgcgtcaaag ccccccagcg cgagcgcatt        60
     ggcgaggtgg ccgacctgct gctggacctc aagttgaaca ccgtttgcca ggaggcaagc       120
     tgcccgaata tcggcgaatg ctttgccgga gggaccgcga cgttcctgat catggggccc       180
     ggatgcaccc gcgcctgtcc ctactgcgat atcgacttcg acaagagcgt ccgcgccctt       240
     gatccaacag aaccccaacg gctcggggag gcggtatccc ggcttgggct taaacacgtc       300
     gtgatcacat cagtgaaccg tgacgaccta gaggacggag gggcgtctca gttcgtggcc       360
     tgcatcgagc aggtgaagca acactcgccg ctcaccacga ttgagctgct cattcccgat       420
     ttctgtggca attgggatgc gctagccacg gtgatggagg catcacccca tgtgctcaat       480
     cacaacattg aaacggtgcc gcggctgtat cgccaagcgc gtccacaggg ggtttacgaa       540
     cgctcccttg aacttctcaa acgggttcgc gatggctggt ctcgggctta cagcaagtcg       600
     ggactgatgg tgggtctcgg cgaaagcgac tcagaagtga tcgaggtgct tcgcgatcta       660
     agagagcacc gagttgacat cgtcaccatt ggccaatacc tatctccagg ccccaaacac       720
     ctgcgggtgg accggttcgt cactccggag cagttcgaga gctaccgcct caagggcgaa       780
     caagaacttg gatttctcca agtggtcagc actccgctta cgcgcagcag ttaccacgca       840
     ggggaagtgc agaaactaat gaccattcat cctcgctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page