(data stored in SCRATCH3701 zone)

EMBL: CP000435.METK

CP000435.METK        Location/Qualifiers
FT   CDS_pept        complement(510969..512228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="sync_0529"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47314"
FT                   /db_xref="GOA:Q0ICR7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICR7"
FT                   /protein_id="ABI47314.1"
FT                   /translation="MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSTSRVACETV
FT                   VNTGLCMITGEVTSKAQVDFIHLVRDVIRDIGYSGARAGGFDATSCAVLVALDQQSPDI
FT                   AQGVDEADDHAGDPLDKVGAGDQGIMFGYACNETPELMPLPISLAHRLARRLAEVRHNG
FT                   TLDYLLPDGKTQVSVVYENDKPVEIDTILISTQHTAEVTGLTDEQEVRNRISEDLWTHV
FT                   VLPATADLPLKPDRANCRYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARYVAKALVAAGLANRAEVQLSYAIGVAKPVSILVESFGSGKVS
FT                   NAELTDLVQEHFDLRPGAIIEQFKLREMPSLNGGRFYRDTAAYGHFGRPDLNLPWEDVG
FT                   DKAASLKQAEANRIQSGSSL"
     atgagtcgat acgttttcac ttccgaatcc gtaacggaag gacatcctga caagatctgc        60
     gatcaagtca gtgatgccgt actggatgct ctcctagccc aagacagcac aagccgggtg       120
     gcctgcgaaa cggttgtgaa taccggtctt tgcatgatca caggtgaagt cacctccaaa       180
     gcccaagtgg attttatcca tcttgtacgc gatgtgattc gagatatcgg ctacagcgga       240
     gcgcgagccg gtggctttga cgccacgagc tgtgccgtac tcgttgccct tgaccaacaa       300
     tcccctgata ttgcccaggg cgttgatgaa gccgatgatc acgccggcga tcccctcgac       360
     aaagtcggag ctggtgatca aggaatcatg tttggctacg cctgcaatga aacgccagag       420
     ctgatgcctt tgcccatcag ccttgcccac agactggcaa ggcgcctggc cgaagtccgc       480
     cataacggaa cactcgatta cctgctccct gacggcaaga cccaggtgag cgttgtctac       540
     gaaaacgaca agccagttga gatcgacacc atcctgatct caacccaaca caccgccgag       600
     gtgactggtt taaccgatga gcaagaggtg cgaaatcgca tcagtgaaga cctttggact       660
     cacgttgtcc tgccagcgac tgccgaccta cctctgaagc ccgatcgcgc caattgccgc       720
     tatctggtca accccaccgg caaattcgtg gtcggtggtc ctcagggtga tgccggtctc       780
     acgggtcgaa aaatcatcgt cgacacctac ggcggctatg cccgtcacgg tggtggtgcc       840
     ttctcaggca aagaccccac caaggtggat cgctccgctg cttatgccgc acgatacgta       900
     gcaaaagcac ttgtggcagc gggtcttgcg aatcgtgcag aagttcaact gagctacgcc       960
     attggagtgg ccaaaccggt atcgatcctt gtggagtctt tcggctcagg caaggtgtcc      1020
     aatgctgagc tcacagacct tgtacaagag cactttgacc ttcgtcctgg agccatcatc      1080
     gagcagttca agctgcgaga aatgccttcc ctcaacggtg gacgcttcta ccgcgacacg      1140
     gctgcctatg gccattttgg ccgcccagat ctcaacttgc cctgggaaga cgtcggtgac      1200
     aaagcggctt ccctgaagca agcggaagcg aaccgcatcc aatccggaag cagcctctag      1260
//

If you have problems or comments...

PBIL Back to PBIL home page