(data stored in SCRATCH3701 zone)

EMBL: CP000435.MINC

CP000435.MINC        Location/Qualifiers
FT   CDS_pept        complement(523187..523900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="sync_0546"
FT                   /product="septum site-determining protein MinC"
FT                   /note="identified by match to protein family HMM PF03775;
FT                   match to protein family HMM TIGR01222"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45059"
FT                   /db_xref="GOA:Q0ICQ1"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ1"
FT                   /protein_id="ABI45059.1"
FT                   /translation="MITSVALTQGTFQTACHRLVLPTNRHIPWQDTLADQLNGLEGKDL
FT                   ELDSGEWLLNCRVLAAFQAQLEERQCRLLSIKSCNPHTVVSANALGIPAQLMTPQPTDP
FT                   RPESREEQQAPALLIHRATLRSGDHLKARHHVLLIGDVNPGAQISAGGNVLIWGRLRGC
FT                   AHAGVQGDLNARITALQLRPLQLRIADLVARGPEEKPQPGLAEEARIVDGEIAIEPADP
FT                   RSDLTIQELSFDLNN"
     ttgatcacgt cggtggcttt gacccaaggg acctttcaaa ctgcatgcca tcgcctagtt        60
     ttgcccacca atcggcacat cccttggcag gacaccctgg cggaccaact caatggtctt       120
     gagggaaaag atcttgaatt ggatagcggg gagtggttgc tgaattgccg agtgctcgct       180
     gcctttcaag cccagcttga ggaacgtcaa tgtcgattgc tgtcgatcaa aagctgcaat       240
     ccacataccg ttgtcagcgc gaacgcgctt ggcattccag ctcagctcat gacgccgcag       300
     cccactgatc ctcgtcctga aagtcgcgaa gaacagcagg ccccagccct gttgatccat       360
     cgagcaaccc tgcgatcggg agaccatctg aaagctcgtc atcacgtttt gctcattgga       420
     gatgtcaatc caggcgctca aatcagcgca ggagggaacg tcctgatctg gggacgcctc       480
     cgtggctgtg ctcatgcggg tgttcaaggc gatttgaatg cacgcatcac ggccttacag       540
     ctccgtccgc ttcagctacg aatcgcggat ctagtcgcca gaggaccaga ggaaaaaccc       600
     caacctggtc tggcggagga agcgcggatt gtggatggag agattgcaat cgagcctgct       660
     gatccccgca gtgacttaac aattcaggag ctttctttcg atttgaacaa ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page