(data stored in SCRATCH3701 zone)

EMBL: CP000435.MSCL

CP000435.MSCL        Location/Qualifiers
FT   CDS_pept        complement(208476..208859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="sync_0202"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47563"
FT                   /db_xref="GOA:Q0IDN4"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN4"
FT                   /protein_id="ABI47563.1"
FT                   /translation="MTRKPGLFADFKAFINKGNVVDLAIAVVIAGAFGKVVATVVTLVM
FT                   TNALEPALKAANVDSINSWPAGTVIVAIINFLVIAFVCFLIVKSIEASKRKQEVIAETK
FT                   PDPQAQLASAMTRLTDALERKGF"
     atgactcgta agcctggttt atttgcagac ttcaaagctt tcatcaacaa aggcaacgtt        60
     gttgatctcg ccattgctgt tgtgattgca ggtgcattcg gcaaggtcgt tgccactgtt       120
     gtgaccttag tgatgactaa tgcccttgag ccggcactca aggcagccaa tgtggactca       180
     atcaattcct ggccagcagg aaccgtgatt gtggcgatca tcaacttcct cgtgatcgcc       240
     tttgtgtgct tcttgattgt gaagtcaatc gaggcctcca aacgcaagca agaggtcatt       300
     gccgaaacca aacccgatcc ccaagctcaa ctggcttctg ccatgactcg cctcacagac       360
     gcactagaac gcaagggttt ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page