(data stored in SCRATCH3701 zone)

EMBL: CP000435.MURB

CP000435.MURB        Location/Qualifiers
FT   CDS_pept        complement(31841..32779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="sync_0027"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02873; match to protein
FT                   family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47331"
FT                   /db_xref="GOA:Q0IE56"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE56"
FT                   /protein_id="ABI47331.1"
FT                   /translation="MFTGDRGLNALLESGVLQQEVPLANYTTWRVGGPAQWLAEPNNAE
FT                   QCLELLQWAKAEGLTTRVIGAGSNLLIADAGLPGLTLCLRRLQGSQLDAESGQVKALAG
FT                   EPLPTLARRAARLGLHGLEWAVGIPGTVGGAAAMNAGAQGGSTADCLTAVEVIDQSLTD
FT                   TVKTTTLLSNTDLAYDYRHSLLQGSDQMVVAAQFQLEPGHDAKELMRKTSGNLSHRTTT
FT                   QPYQWPSCGSVFRNPEPEKAGQLIEGLGLKGRRIGGAEVSSVHANFIVNVGDATADDIR
FT                   ALIDLVQNEVERMNGITLHPEVKRLGFQTTD"
     atgttcaccg gcgatcgcgg cctgaatgcc cttctcgagt cgggggttct ccaacaggag        60
     gtgcccctcg cgaactacac cacttggcgg gtgggaggtc cagctcaatg gttggccgaa       120
     cccaacaatg ctgagcaatg tcttgagctt ctccaatggg ccaaagctga aggtctgacg       180
     acccgagtga ttggagcggg atcgaacctg ctcatcgctg atgctggtct tccgggcctc       240
     acactttgct tgcgccgtct ccaaggcagc caactggatg ccgaatcagg gcaggtaaaa       300
     gccttggcgg gtgaaccact tccaacactc gccaggcgcg cagccagact tggattacat       360
     ggactggaat gggccgttgg catccctgga accgtgggtg gggccgcggc catgaacgcc       420
     ggagcccaag gcggctcaac agccgactgc ctgacagccg tggaggtgat cgatcaatcg       480
     ttaacggaca cggtgaagac caccacgctg ctcagcaata ccgatctcgc ctacgactac       540
     cgacacagcc tccttcaagg cagcgaccaa atggtggttg cagcgcagtt ccaattggaa       600
     cctggccacg acgccaagga attgatgcga aagaccagtg gcaacctcag tcaccgcacc       660
     accacccagc cttaccaatg gccaagctgc gggagtgtgt tccgcaaccc agagcccgaa       720
     aaagctggtc agctcatcga gggcttaggg ctcaagggga gacgtatcgg aggcgctgaa       780
     gtctcttcgg tgcatgccaa tttcatcgtg aacgtcggcg atgccacagc cgatgacatc       840
     cgcgccttaa tcgacttagt gcagaacgaa gtggaacgta tgaacggaat cactttgcat       900
     cctgaagtga aacgcttggg ctttcaaacg accgattag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page