(data stored in SCRATCH3701 zone)

EMBL: CP000435.MURC

CP000435.MURC        Location/Qualifiers
FT   CDS_pept        complement(32755..34206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="sync_0028"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46504"
FT                   /db_xref="GOA:Q0IE55"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE55"
FT                   /protein_id="ABI46504.1"
FT                   /translation="MADSIQPEKHIHFIGMGGIGMSALALILAERGHSVSGSDRKLTPA
FT                   MQALETKALAIFESQVSKNFAHLQSRGIEEPLVVVSTAIPSTNPELIEAQRLDLTIWHR
FT                   SDLLAWLIEQQPSIAVAGSHGKTTTSTVLTTLLATVGEDPTAVIGGVVPCYGSNGHKGN
FT                   GRLLVAEADESDGSLVKFKASLGIITNLELDHTDHYRNLDDLIETMKTFGRGCKRLLIN
FT                   HDDPILKEHFQADACWSVHHVETADYAALPVQLDGDRTIADYFEQGQKVGQITLPLPGL
FT                   HNLSNVVAALAACRMEGVPLEALLLAVTELRSPGRRFDFRGEWQDRQVVDDYAHHPSEV
FT                   QATLTMAQLMVQSGRSPLPRTPQRLLAVFQPHRYSRTQEFLNAFAQALVSADALVLAPI
FT                   YGAGEQPIEGINSELLARSIRLIDPNQPVFVASTMEELAGLVKQHSQPDDLILAMGAGD
FT                   VNSLWERLSQEGIGGEASCSPAIAA"
     ttggccgatt cgatccagcc cgagaagcac attcacttca ttgggatggg tggaatcggc        60
     atgtcggcac tggctctgat ccttgctgaa aggggccatt ccgtgagtgg atccgaccgg       120
     aaactcacac ctgcaatgca ggcccttgag accaaagcac tcgccatatt cgaaagccag       180
     gtctcgaaga attttgccca tctccaatca cgcggcattg aagagccctt ggtggtggtc       240
     agtacggcca taccgagcac caatccagag ttgatcgaag cgcagcgctt ggatctaacg       300
     atttggcatc gctccgacct tttggcctgg ttgatcgagc aacaaccctc catcgctgtg       360
     gctggtagcc atgggaaaac caccacaagc actgtcttga ccaccctcct cgccacggtt       420
     ggcgaagacc ccacagcggt gattggtggt gtcgtcccct gttacggaag caacggtcac       480
     aaaggcaacg gtcgtctcct tgtcgctgag gccgacgagt ccgatggatc actggtgaag       540
     ttcaaggcca gtctcgggat catcaccaat ctcgaactgg accatacaga ccattaccgc       600
     aatctcgacg acttgatcga gacgatgaaa acctttggcc gcggctgcaa acgcctactc       660
     atcaatcacg acgatccaat tctgaaagaa cactttcaag ccgatgcctg ttggtctgtt       720
     caccatgtcg aaacagcgga ttacgccgct ttacctgtgc aactcgatgg agatcgcacc       780
     atcgccgact atttcgagca agggcaaaag gttggtcaaa tcacgcttcc cctgccaggc       840
     ctgcacaacc tgagcaacgt agtggccgcc ctggcggctt gccgcatgga gggggttccc       900
     ttggaggctc ttttgttggc agtaaccgaa ctgcgttcgc caggtcgtcg ctttgatttc       960
     cgaggcgagt ggcaagaccg acaagtggtt gatgactatg cccatcaccc cagcgaagtt      1020
     caagcaactc tgaccatggc ccagctgatg gtgcaaagcg gccgaagccc cttaccccga      1080
     acaccccaac gccttctcgc tgttttccaa ccgcaccgct acagccgcac acaagaattt      1140
     ctcaacgcct ttgcccaggc actcgtgtcc gctgacgccc tcgttcttgc cccgatttat      1200
     ggcgctggtg aacaaccgat cgagggcatc aacagtgagc ttctggctcg ctccattcgg      1260
     ctgatcgatc ccaatcagcc cgtctttgtg gctagcacta tggaagagct cgcaggtctg      1320
     gtgaaacaac acagtcagcc tgatgacttg attttggcga tgggtgctgg agatgtgaac      1380
     agtctctggg aacgcctgtc acaggaagga attggaggag aggcgtcatg ttcaccggcg      1440
     atcgcggcct ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page