(data stored in SCRATCH3701 zone)

EMBL: CP000435.NRDR

CP000435.NRDR        Location/Qualifiers
FT   CDS_pept        complement(514273..514749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="sync_0532"
FT                   /product="transcriptional regulator, NrdR family protein"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47722"
FT                   /db_xref="GOA:Q0ICR4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICR4"
FT                   /protein_id="ABI47722.1"
FT                   /translation="MQCPSCQNTDSRVLESRAAEGGRSVRRRRECLNCEFRFTTYERVE
FT                   MVPITVIKRNGHREIFNRSKLLHGLSRACEKTGLTPSKLEEIVDNLELSLQQSSSREIT
FT                   SSEIGELVLSHLKGLSEVAYVRFASVYRHFRSVSDFVSTLEGMNADKAELAALV"
     atgcagtgcc cctcctgcca aaacacggat agccgggttc tcgagtcgag agcagccgag        60
     ggcggaagaa gtgtgcgtcg gcgtcgtgaa tgcctaaatt gtgaattccg attcacgact       120
     tacgagcggg tagagatggt tccaatcacc gtgatcaaac gcaatggtca tcgtgagatt       180
     tttaaccgca gcaaactgct tcacggccta agccgagcct gcgaaaaaac tgggttaacg       240
     ccaagcaaac tcgaagagat cgttgacaat ctcgaactca gtcttcagca aagcagtagc       300
     cgtgagatca ccagttcaga gattggtgag ttggtgctga gtcatctcaa ggggctcagc       360
     gaagtcgctt acgtgcgttt tgcctcggtg tatcgacact ttcgaagcgt tagcgatttc       420
     gtctccacgc tcgaggggat gaacgcagac aaagctgaac tcgccgcact cgtctaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page