(data stored in SCRATCH3701 zone)

EMBL: CP000435.PDXA

CP000435.PDXA        Location/Qualifiers
FT   CDS_pept        complement(38620..39648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="sync_0034"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45100"
FT                   /db_xref="GOA:Q0IE49"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE49"
FT                   /protein_id="ABI45100.1"
FT                   /translation="MSFSHPSSDATHRLVIALGDPAGIGMEVTLKALADPRLPDGLNPL
FT                   VVGCRKTLEQTYTRLKAQQCPLLMDPSNLDIDDLPIHDAITPGRPSPESGASSFRWLSH
FT                   AVSRVKEAQTLALVTAPIAKHAWHAAGHDYPGQTERLAELDNARQASMLFTAVSPNHGW
FT                   RLNTLLATTHIPLQEVPTALTPDLILRKLDVLSEFCLRFNPNPRLLVAGLNPHAGEQGR
FT                   LGSEETNWLIPALHQWQHNHPHIYLSGPLPPDTCWLSAAKAWQQGGQAESPDGILALYH
FT                   DQGLIPMKLMAFDEAVNTTLGLSFLRTSPDHGTGFDIAGQGVARSTSMVAAIRAAWELS
FT                   RA"
     atgtccttct ctcatccctc ctctgacgct acccaccgcc tggtgattgc tctcggtgat        60
     cctgctggaa tcggcatgga agtcacgttg aaagccctcg cagaccctcg attgccagat       120
     ggactgaacc cactcgtcgt tggctgccga aaaactttgg agcagacgta caccaggctc       180
     aaagcccaac agtgccccct gctgatggat cccagcaatc tggacattga cgatctaccg       240
     atccatgacg caatcacccc tgggagacca agccctgaaa gcggcgcatc cagttttcgc       300
     tggctgagtc atgccgtctc acgcgtgaaa gaggcgcaaa cactggcttt ggtcacagcg       360
     cccattgcga aacatgcctg gcatgccgca ggacacgact atccaggcca aacagagcgt       420
     ttggcagaac tcgacaatgc gcgtcaagcc tcaatgctgt tcacagccgt ctcaccaaac       480
     catggctgga ggctgaacac ccttcttgcc acaacgcaca ttccactgca agaggttccc       540
     actgcactca cccccgacct catactccgc aagctggacg tgctcagcga gttctgtctg       600
     aggttcaatc ccaacccgcg cttgctcgtt gctggcctca atccccatgc tggagaacag       660
     ggccgccttg gcagtgaaga aaccaactgg ctcatccccg cactccacca gtggcagcac       720
     aaccatcccc acatctattt gagcgggcct ctgccccctg acacctgctg gctcagcgct       780
     gccaaggcct ggcagcaagg aggtcaagcg gaatcaccgg atggaatcct cgctttgtat       840
     cacgaccaag gcttaatccc catgaagctg atggccttcg atgaggccgt gaacaccacg       900
     ctcggactgt cgttcctgcg cacctcacca gaccacggaa ccggcttcga tatcgcagga       960
     cagggggtgg cgagatcgac gagcatggtg gcagcgattc gggccgcctg ggagctcagc      1020
     cgggcttaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page