(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE101

CP000435.PE101       Location/Qualifiers
FT   CDS_pept        110274..111266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0103"
FT                   /product="Sugar kinase, ribokinase family protein"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47458"
FT                   /db_xref="GOA:Q0IDY2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY2"
FT                   /protein_id="ABI47458.1"
FT                   /translation="MADLSALAPRVMCLGEALVDRLGPLGGDPVTAAPESCDDRLGGAP
FT                   ANVACALARLGTPVGLVGRLGEDSIGSAFRDLFQQRGVAVQALQRDVSHPSRVVLVRRH
FT                   ANGERVFQGFAGDHALGFADQMLNLGELEAVWPMVSKQARWLLVGTIPLATPTSADSLQ
FT                   WLLAQAQAASLALAVDVNWRPTFWDPEADPAAGPTADALAVIKPLLEQASLIKLAREEA
FT                   LWFFGSDDPAAVAKDLPQQPDVVVTDGANPIRWFIEHEAGSMPVFQPSQVIDTTGAGDA
FT                   FTAGLLHCWDRPVNERLYFASACGALVCSGAGAIDPQPQEQDVLTFLNR"
     atggccgatc tttctgcttt ggctcctcgt gtgatgtgcc tgggtgaggc attggttgat        60
     cgacttgggc cgctgggggg agatcccgtg acggcagctc ctgaatcttg tgatgatcgt       120
     ttgggcggtg cacctgcgaa cgtggcctgt gctcttgccc gattgggcac tcctgtcggt       180
     ctggttggtc gacttggtga agactcaatt ggttctgcct ttcgtgatct atttcagcag       240
     cggggtgtgg ctgttcaagc ccttcaacgc gatgtaagtc acccaagtcg ggtggtgttg       300
     gttcgccgcc atgccaatgg tgagcgtgtg tttcagggtt ttgcaggaga tcacgccctg       360
     gggtttgccg atcagatgct gaatcttggc gaattggaag cggtttggcc gatggtgtcg       420
     aagcaggctc gctggttgct cgttggaacg attccattgg caacgccaac ttctgctgat       480
     tcgctgcagt ggttgttggc tcaagcccag gcggcaagcc ttgcgcttgc tgtagatgtg       540
     aattggcgcc ccacgttttg ggatcccgag gcagatccag cagctggtcc taccgctgat       600
     gcattggcgg tgatcaagcc gttgttggaa caggcctccc tgatcaaatt ggctcgggag       660
     gaggcgttgt ggttcttcgg cagtgatgat cctgctgctg tcgctaaaga tttgccgcag       720
     cagcccgatg ttgttgtaac cgatggagcc aaccccattc gctggtttat cgagcatgag       780
     gctgggagta tgccggtgtt tcagccttct caggtcatcg acaccactgg ggcaggggac       840
     gcgttcactg cgggtctatt gcactgttgg gatcgtcccg tgaatgagcg gctgtacttt       900
     gcgtcagcct gcggtgctct tgtttgcagc ggtgccggag ccatcgatcc acagccgcaa       960
     gagcaggatg ttctcacctt cctgaatcga tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page