(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE102

CP000435.PE102       Location/Qualifiers
FT   CDS_pept        complement(111384..112280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0104"
FT                   /product="probable sugar kinase YPO1816 , putative"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45221"
FT                   /db_xref="GOA:Q0IDY1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY1"
FT                   /protein_id="ABI45221.1"
FT                   /translation="MPALPNAGQIVETSLMELCLGGCAANTAYDLAKLGVDVCLGGCIG
FT                   EDPFGDFLLRTLEEAGVQTTGVSRCSQATTATSAVINVEGGDRRLISVVGANRLFKCSM
FT                   IPEGLIESAAVIHIGGFLLLDALESVQTQERLQQARANGALVVLDVIEVKDPLAMERVQ
FT                   RVLPFTDVVLPNRDEAALLTGRKNPWDQAQMFGDAGASTVVITDGAQGTYVVTDGLRLR
FT                   SDAYSTSFLGGTGAGDAFDAGFIAGYLNGEDLKGCVRWGSAMGASCVRSTAATSSVFSK
FT                   EEALRFMGNHTLHIHEV"
     gtgccggcct tgccaaacgc cggtcaaatc gtagagacct ccctaatgga actttgctta        60
     gggggctgtg ctgccaatac cgcttacgac ttggccaagt tgggcgtaga tgtgtgttta       120
     ggggggtgca ttggagaaga tccattcggc gactttcttc tgcgaaccct ggaggaagct       180
     ggagttcaaa ccactggggt aagccgctgc tcccaggcca cgaccgcaac atcagctgtg       240
     atcaatgtgg aggggggtga tcgacgcttg atctcagtgg tgggagccaa ccggcttttc       300
     aaatgcagca tgattccgga gggcctgatc gaatccgcag ccgtcattca tatcggcggc       360
     tttctcttgc tagacgccct cgaaagcgtt caaacccaag aacgccttca acaggcccgc       420
     gctaacggtg ctcttgtggt gctggatgtc attgaggtca aagaccctct tgccatggaa       480
     cgggtgcagc gcgttttgcc cttcaccgac gtggtgctcc cgaatcgtga tgaagcggct       540
     ctcttgactg ggcgtaagaa cccttgggac caggcacaga tgttcggcga tgccggagct       600
     agcacggtgg tgattacgga tggtgctcaa gggacctatg tcgtgaccga tggactgcgc       660
     cttcgtagtg atgcttattc cacctccttt ctcggcggga cgggcgccgg ggacgccttt       720
     gacgcagggt tcattgctgg gtatctcaac ggggaggacc taaaaggctg cgtacgctgg       780
     ggaagcgcca tgggtgcaag ctgcgtgcga agcaccgcag cgacatccag cgtgtttagc       840
     aaagaagaag cactccgctt catgggaaat cacacccttc acatccacga ggtctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page