(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE104

CP000435.PE104       Location/Qualifiers
FT   CDS_pept        113842..115455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0106"
FT                   /product="transporter, solute:sodium symporter (SSS) family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47705"
FT                   /db_xref="GOA:Q0IDX9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX9"
FT                   /protein_id="ABI47705.1"
FT                   /translation="MVGLARCCCFGISGAFSGCIGPAVLGWPACLGVDVHRPSGGTHPD
FT                   RCLDRPPMTTTLISALISLVVYLLALLWLGAQSLGGQTNSADSYFLADRRLRAGVLFFT
FT                   LIATNFSAFFFLGFAGAGYRIGIAYYPMMAFGTGLAALSFGSLGCRVRRLSAQHGLITP
FT                   SELIGHLLPGEGVRLLVLAVMVLFTLPYLALQPLGAGYLLESLTGGVVPFEVGAVLLTV
FT                   VIVLYVVGGGMRAVARTDVLQGVLMFLLMLMAFVAVAVGVGGVQTANRTLLQQLPDLFS
FT                   GAGRNDFFTPRMMASYLLLWPLCLPMFPQMLMRFFAAGDDRSLKQSMVLYPVVAGVLFI
FT                   CPVMIGMWGHLAFPDLVGRASDQIMPLMLGRYSPEWLTGIVMVGALAAFMSTLDSQLLA
FT                   LSSMLTRDLYKRYWRPQASLPEQVRVGQLVVIALAVSGLVIALRPPEAILSLATHAFSG
FT                   LALLFPMLVGAVYGLRWSVIGAILSVIGGEAVLLGFATGVIPEVFQGGCLPLIPALVVA
FT                   CSILVVDQVISRWSSSFLQA"
     atggttggcc ttgctcgctg ctgttgcttt ggcattagtg gtgcattttc aggctgcatc        60
     ggccctgccg ttttgggctg gcctgcctgc ctgggtgttg atgttcatcg tccttcaggc       120
     ggcactcacc ctgatcgctg cttggatcgc ccgcccatga ccaccaccct gatttctgcg       180
     ctcatctctc ttgttgtcta tctgctggct ttgctctggc taggtgctca aagtcttggg       240
     ggacaaacca acagcgccga ctcctatttt ttggccgatc gccgcctgcg tgccggcgtg       300
     ttgtttttca cgctgatcgc gaccaacttc agtgcttttt tctttcttgg ctttgccggg       360
     gcgggatatc gaatcgggat tgcctattac ccaatgatgg cttttggaac aggattagct       420
     gctctcagct tcggcagcct tggctgtcgg gtgaggagac tcagcgctca acatggcctc       480
     atcactcctt ctgaattgat cggccatctc ctgcctggag aaggggtgcg cttattggtg       540
     cttgcagtaa tggtgctgtt cacccttcct tatttggctc tgcagccatt gggtgcgggg       600
     tatttgctgg aaagtctcac tggaggcgtc gttccttttg aagtgggagc agtactgctc       660
     acggttgtga ttgtgctcta tgtcgttggc ggtggtatgc gagctgtggc ccgcaccgat       720
     gtgcttcaag gagtgctgat gtttttgcta atgctgatgg cttttgtggc tgttgccgta       780
     ggtgtgggtg gagttcaaac cgcaaatcgc acgcttttgc aacagcttcc tgatctcttt       840
     agcggggctg gacgcaatga tttttttacg cctcgaatga tggcgagcta tttgctcctt       900
     tggccgttat gtcttccgat gttcccgcag atgctgatgc gttttttcgc tgctggggat       960
     gaccgctcgc tgaaacagtc gatggtgctt tatcccgtcg tggcgggagt gctgtttatt      1020
     tgtccagtga tgatcgggat gtgggggcat ctggccttcc ccgatctggt gggtcgcgca      1080
     tccgatcaga tcatgccgtt gatgctgggg cgttacagcc cggagtggct gacaggaatc      1140
     gtgatggtgg gggctttggc tgcgtttatg tccactttgg attcgcaatt gttggccctg      1200
     tcttccatgt tgacccgcga cttatataag aggtattggc gcccacaagc atctttgccg      1260
     gagcaagtgc gtgtcgggca gctggtggtg attgcacttg ctgtctctgg tctggtcatt      1320
     gcgcttcgtc cgccggaggc gattttgtcg ctggcaaccc atgcgttttc gggtctcgct      1380
     ttgttgttcc cgatgctggt gggggcggtt tatggcctgc gatggtccgt tattggcgcc      1440
     attttgtcgg tcatcggggg agaagccgtt ctgctggggt ttgcaaccgg cgtgattcca      1500
     gaggtgttcc aggggggctg tttgcctttg attccagcac tggtggtcgc atgctcgatt      1560
     ttggttgtgg atcaggtcat ctctcgctgg tcgtcgtctt tcttgcaggc atga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page