(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE109

CP000435.PE109       Location/Qualifiers
FT   CDS_pept        119111..120163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0111"
FT                   /product="Rod shape determining protein"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46505"
FT                   /db_xref="GOA:Q0IDX4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX4"
FT                   /protein_id="ABI46505.1"
FT                   /translation="MLFRRFQLSRDIGIDLGTANTLIYVSGKGIVLQEPSVVAIDLERG
FT                   VPLAVGDEAKLMLGRTPGNIRAVRPLRDGVIADFDAAEQMLKSFIQKGNEGRGIIAPRL
FT                   VVGIPSGVTGVERRAVREAGLAGAREVHLIDEPVAAAIGAGLPVTEPVGTMIVDIGGGT
FT                   TEVAVLSLGGTVLSESVRVAGDEISDSIGVHLKKVHNLVVGERTAEDIKIRIGSAFPDN
FT                   DFDQTVMDVRGLHLLSGLPRTIQLQAGDLREAIAEPLNVIVEAVKRTLERTPPELAADI
FT                   VDRGIMLAGGGALVRGISDLISHETGIFTHVAEDPLLCVVNGCGQVLEDYKRLQRVLDT
FT                   PEFVRSATSL"
     gtgctttttc gtcgatttca gctttcccgt gacatcggta tcgacctcgg cactgccaat        60
     accctgattt atgtctccgg caaggggatt gtgttgcaag agccttcagt ggtggcgatt       120
     gatctcgagc ggggggtgcc cctggcggtc ggtgatgaag cgaagctgat gctgggccgt       180
     acgcctggga atattcgtgc ggtgcggccc ctgcgtgatg gtgtgatcgc tgattttgat       240
     gcagctgagc agatgctcaa aagtttcatt caaaaaggca acgaggggcg cggaatcatt       300
     gccccacgcc tggtggtggg gatccccagc ggtgtgacgg gtgtggagcg ccgtgccgta       360
     cgtgaggcag gcctggccgg tgccagagaa gtgcatctca tcgacgagcc cgtggccgcg       420
     gcgattggtg ctggtttgcc ggtgacggag ccagtcggca cgatgattgt ggatattggg       480
     ggaggaacca ccgaagtggc ggtgctcagc cttggaggca ccgtactgag tgaatccgtt       540
     cgagttgccg gtgatgaaat cagcgattcg atcggtgtcc atctcaaaaa ggttcacaac       600
     ctggtggtgg gcgagcgcac tgccgaagac atcaagattc gaatcggttc cgcattccca       660
     gacaacgact tcgatcagac ggtgatggat gtgcgtggct tgcacctcct gtctggtttg       720
     ccgcgcacga ttcagctcca agctggtgac cttcgtgagg ccatcgctga gcccctcaat       780
     gtgattgttg aggcggtgaa acgcacgctc gaacgcaccc cccctgagct ggcggcagac       840
     atcgttgatc gcggaatcat gcttgccggc ggtggggccc tggtgagggg gattagtgac       900
     ctgatcagcc atgaaacggg gatcttcacc cacgttgcgg aagatcctct tctctgcgtg       960
     gtgaatggct gcggtcaggt gcttgaggat tacaagcgcc tgcagcgtgt gctggataca      1020
     cccgaattcg ttcgttctgc tacgagcctc taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page