(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE112

CP000435.PE112       Location/Qualifiers
FT   CDS_pept        121380..122723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0114"
FT                   /product="Bacterial extracellular solute-binding protein,
FT                   family 1"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45680"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX1"
FT                   /protein_id="ABI45680.1"
FT                   /translation="MATSDLATAHSRMIQHTSHRRRWLALALLSTSLLIGGCRRAAAPE
FT                   GALQLWTLQLAPKFNTYMEQVIDRWDDGHPDAPVRWTDLPWGSVERKLLAAVFARTAPD
FT                   VVNLNPPFAANLASKGGLTDLTPLLPPDAAQRYLPSVWRAARDPKAGQIAVPWYLTVRL
FT                   SLVNQKLLQQAGVNAPPRRWEDVPAFARQIRERTGRYGLFVTAVPDDSAELLESMVQMG
FT                   VVLLDDKQRAGFNSPEGRKAFAFWTDLYREGLLPREVVSQGQRRAIELYQSGQLALLAS
FT                   GAEFLRSIQTNAPGVAAVTSPQPPLTGGDGTANVALMTLAVPRQSQRAQEALSFALDLT
FT                   NGPNQARFAREARVLPSSLEALRQVRAELEAERPATPELAQVREARLLSAKTLERARVL
FT                   VPATPGVKRLQSIVYTQLQRAMLGQISSEEAVRTAAEQWNRYSEARWP"
     ttggcaactt ctgatctggc gacggcgcac tcccgcatga ttcagcacac ttcccatcgc        60
     cgtaggtggc tggccctggc tcttctcagc acctcgttgc tgatcggggg ctgccggcgt       120
     gccgcagcgc cagaaggagc tctccagctt tggacgctgc aactagcgcc caagttcaac       180
     acttacatgg aacaggtgat tgatcgctgg gacgatggcc atccagatgc accggtgcgt       240
     tggaccgact tgccttgggg ttctgtggaa cggaagctcc tggctgcagt gtttgctcgc       300
     actgccccgg atgttgtgaa tctcaatccc ccctttgcag ccaatttggc aagcaagggt       360
     gggttgaccg atctcacgcc gctgttgcca ccggatgccg ctcagcgcta tttgccttcg       420
     gtgtggcgtg cggcacgcga tccaaaggct ggccagatcg ccgtgccctg gtatctcacg       480
     gtccgcctca gcttggtcaa tcagaagctg ctgcaacagg cgggcgtgaa cgcgccgcct       540
     cgtcgctggg aggatgttcc tgcctttgct cgtcaaattc gagagcgaac gggacgttac       600
     ggcctttttg tcacggctgt gcccgacgat tcagccgaat tgctggagtc gatggtgcag       660
     atgggggttg ttttgctgga tgacaaacag cgagcgggat tcaactctcc agaggggcgt       720
     aaggcgtttg cgttttggac cgatctgtat cgagagggcc ttctccctag ggaagtggtc       780
     agtcaggggc aacgccgggc gattgagctt taccaaagtg gacagctcgc gctgctggcc       840
     agtggggctg aatttttacg cagcatccag accaacgccc ctggcgtggc ggcggtgacc       900
     tccccgcaac cgcccctcac aggaggcgat ggcaccgcca acgtggcttt gatgacgctt       960
     gccgttcctc gccagagtca gcgcgcgcaa gaggcgttgt cgtttgcact cgatctcacc      1020
     aacgggccga accaagcgcg ctttgcgcgc gaggccaggg tgttgccctc ctccctagag      1080
     gcgctcaggc aggtgcgtgc tgagcttgaa gctgagcgtc ctgcaacccc tgagttggct      1140
     caagttcgag aagcaaggct tctctcggcc aagacgctgg agcgggccag ggtcctggtc      1200
     cctgcgacgc ccggcgtcaa gcgtcttcag agcatcgtgt acacccaact acagcgggcg      1260
     atgttgggtc agatcagcag tgaggaggca gtgcgtacgg ctgctgagca gtggaaccgt      1320
     tactcagagg cgcgatggcc ctaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page