(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE113

CP000435.PE113       Location/Qualifiers
FT   CDS_pept        122862..123629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0115"
FT                   /product="two-component response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46316"
FT                   /db_xref="GOA:Q0IDX0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX0"
FT                   /protein_id="ABI46316.1"
FT                   /translation="MPTDGPSVKGTILVVDDEPAVRRVLLMRLQLAGYNVVSAEDGEEA
FT                   LEKFHSESPDLVVLDVMLPKMDGFAVCRRLRAESCVPIIFLSALESISERVAGLDLGAD
FT                   DYLPKPFSPKELEARIFTILRRVGSGSATVEPREIPSGQGVMRVGDLVVDTNRRQVNRG
FT                   TERIALTYTEFSLLELLFRDPGHVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKL
FT                   EPDPRNPEMILTVRGIGYSSQRMGEPAGAPAAV"
     atgcccacag atgggccttc tgtaaaagga accattcttg tggttgacga cgagcccgca        60
     gtgaggcggg ttttgttgat gcgtctgcaa ttggctggtt acaacgtcgt ctccgctgag       120
     gatggtgagg aggcgctgga aaagtttcac agtgaatcgc cggatctcgt cgttctcgac       180
     gtgatgcttc caaaaatgga tggctttgct gtctgcaggc gcttacgcgc tgagtcatgc       240
     gttccgatta tttttctttc ggctttggag tccatctctg agcgcgtggc tggccttgac       300
     cttggagctg acgactatct tccaaagccc tttagcccaa aggaacttga agcccgcatt       360
     ttcacgatcc tgagacgggt ggggtccggt tctgccaccg ttgagccccg cgagattccc       420
     agtggccaag gggtgatgcg tgttggagat ttagtggttg acaccaatcg ccgtcaggtg       480
     aatcggggaa cggaacgcat cgctctgaca tacacagaat tcagccttct tgaattgctc       540
     ttccgcgacc cgggtcatgt ggtcccgagg gccgaaatcc ttgagcagct ttgggggtat       600
     ccgccccgac gtgcggctga cctaagggtt gttgatgtgt acgtggcacg cctgcgagga       660
     aagcttgagc ccgacccgcg taatcctgaa atgattctca cggtgagagg gatcggctac       720
     tcgtcccaac gcatgggcga acctgcagga gcacctgcag cagtttga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page