(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE116

CP000435.PE116       Location/Qualifiers
FT   CDS_pept        complement(125502..125987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45461"
FT                   /db_xref="InterPro:IPR030812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW7"
FT                   /protein_id="ABI45461.1"
FT                   /translation="MSPTWLDHLERGLEERLEQFLRSNPSQDQLLREQHLQDRQRDLHN
FT                   RRGQQQLQARELRRQLLTLAEQVQAWTTRGEKARRAGALELAQRADQHVAALMQQGREL
FT                   WEEFEALGLQFAELEEQLNSLKSQEKQSTSRRSLDEDWALFEAQQELEELRRNQGLS"
     atgagtccca cctggctgga ccacctcgaa cgcggcttgg aggaaaggct tgaacagttt        60
     ttgcgcagca atccaagtca ggatcaactt ctgcgcgaac agcatctcca ggaccgccaa       120
     agggatcttc acaaccgtcg cgggcaacag caactccaag cgagggaatt acgccgtcag       180
     ctgctcaccc ttgccgaaca ggtccaagcc tggacaacgc gtggcgagaa agcacgaagg       240
     gctggtgccc ttgaactcgc acaacgggcg gatcagcacg ttgctgctct gatgcagcaa       300
     ggtcgcgagc tctgggagga gttcgaggcg cttgggcttc agttcgccga actcgaagag       360
     cagctcaaca gccttaaatc ccaggaaaaa cagtccacat cgcggcgcag ccttgatgag       420
     gactgggctc tatttgaagc gcaacaagag cttgaagaac tgaggcgcaa tcaaggcctc       480
     agctaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page