(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE120

CP000435.PE120       Location/Qualifiers
FT   CDS_pept        128551..130629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0122"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45695"
FT                   /db_xref="GOA:Q0IDW3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW3"
FT                   /protein_id="ABI45695.1"
FT                   /translation="MIGTLLSERYRLDQCLTSDQSAPQGTLWRGTDVLASDAPVALRQL
FT                   QDSEAQDRFRQLWPAMQSVLHPLIPRFGGLLEELDSLWLVREWQEGSSFGQIQQQRRER
FT                   QLVFGGGEVLLLLRQLLPVLGVLHGKGLVHGDINPSNLLRRDQDGLPVLLDFGLLQNLG
FT                   TAPLLGATASYAPRGQGRGETAAPWMDLHALGVTALTLLSGRAPEALLPADASEWQCPP
FT                   DLELHEGFRDVLERMLSEVPGRRFEKASEVLQALKVVPMPESTGPMPSSDRTVVLAPVV
FT                   LASAELPVVEPQAVGPSSPEPRRRQRADERQVAAEGRLWPVVIALLLSALVGTAIGWFL
FT                   LSRGNAPSGVPSTERDVVGRSPTASLPPAEVDQRQQLLSRLRALQVDRSWFLQLVDASL
FT                   LARFPERNGRLPSDSLEDAPLRKVWNELANEWLARVEQLPPGLRSRLGKLDQKDWQTQR
FT                   QALVAQGVNDRVVEQLVSVAANTLLPGVTYGTKPPEPFRQLWFAAALRSLEEVKIERIR
FT                   AGAEMATVLSSRVPADSARLISIQVPANRRLVLGINGTPLMQMTVYAADGSVAAERGPL
FT                   RVVTLAADVGTPVQVLVTNEGVASGLLTLSSRADLPNPNPVPKAVSKPLPRVDLNPIAD
FT                   PATGVQGPVEALPEPPGPKPAGVKEDVSQEQSLQEPSAQPEGDRVPEAASSTGLSRQ"
     gtgatcggca cgctgctctc tgagcgctac cgcttggatc aatgtctgac gtcagatcag        60
     tccgcacccc agggaacgct ttggcgtgga accgatgtgt tggcatcaga tgcgccagtg       120
     gcattgcggc agcttcagga ttccgaggct caagaccggt tccggcagct atggcccgcg       180
     atgcaatcgg ttctccaccc actgattcca cgattcggag gtctgctgga ggaattggat       240
     tcgctctggc tggtcaggga gtggcaagaa ggatccagct ttgggcaaat ccagcagcag       300
     aggcgtgagc gtcagctcgt gttcggtggc ggcgaagtgt tgttgttgtt gcgccagctg       360
     cttccagtgt tgggcgttct gcatggaaag ggactggtcc atggcgatat caatcccagc       420
     aaccttcttc gccgtgatca ggatggactg ccggttttgc tcgattttgg tctgcttcaa       480
     aacctgggaa ccgccccgct tttaggagct acggctagct atgccccgag ggggcaaggc       540
     cgcggcgaga cggccgcgcc atggatggat ttgcatgctc tcggcgtcac cgcactgacc       600
     ttgctgagcg gacgtgcccc ggaggccttg ctgccggccg atgccagcga atggcaatgc       660
     ccccctgacc tagagctcca tgaagggttc cgcgatgtgt tggaacgcat gctgagcgag       720
     gtgccaggtc gccgttttga gaaggcctcg gaggttttgc aggccttgaa agtggttcct       780
     atgcctgaat cgaccgggcc catgccgagt tcggatcgaa cggtcgtgct tgctcctgtg       840
     gtgctggcct ctgcggaact ccctgtcgtg gaaccgcagg ctgttggccc ctcttcccct       900
     gagcctcgcc ggcgtcagcg cgctgatgag cgccaagtgg ctgcggaagg gcggctatgg       960
     cccgtggtga ttgctctcct gttgtcagcg ctagtgggca ctgcaatcgg ctggttcctt      1020
     ctaagtcggg gtaatgctcc ctcgggtgtc ccatccaccg agcgtgatgt ggtgggccgc      1080
     tcgccgacgg ccagcctccc gccggcagag gtggatcagc gtcaacaact tcttagtcgg      1140
     ctcagggctc tgcaggtgga ccgcagctgg ttcttgcagc ttgtggatgc cagcttgttg      1200
     gcccgattcc cggagcgaaa cggtcgcttg cccagtgatt cccttgagga tgcgcccctt      1260
     cgcaaggttt ggaacgagtt ggccaacgag tggttggcca gggtggagca gttgcctcca      1320
     gggttgcgca gtcgcctcgg gaaactcgat caaaaagatt ggcaaaccca gcgtcaggcc      1380
     ctcgtcgccc aaggggtgaa tgacagggtg gtggaacagc tggtctccgt ggcggccaac      1440
     accctgttgc cgggtgtgac ctatggaacc aagccgccag aacccttccg gcagctttgg      1500
     ttcgcggctg ccttgcgcag tctggaagag gtcaagattg aaaggattag ggcaggggct      1560
     gagatggcta ccgtgctttc cagtcgggta ccagccgata gcgcgcgcct gatttccatt      1620
     caggttccgg ccaatcgtcg gttggtgctc ggtattaatg gaacaccgtt aatgcagatg      1680
     acggtctacg ccgctgacgg ctctgtggct gcagaacggg ggcctttgcg agtggtcacc      1740
     ctggcggctg atgtgggcac gcctgtccag gtgctcgtga cgaatgaggg cgtcgcctcc      1800
     gggcttctga ccttgtcctc tcgagctgac ctcccgaatc cgaaccctgt gccgaaagct      1860
     gtatcaaaac cactgccaag ggtggatctc aatccgattg ccgatccggc gacgggggtg      1920
     caggggcctg tagaggcgtt gccggagccc cctggcccga agccagcagg tgtgaaggag      1980
     gacgtctccc aagagcaatc cctccaagag ccatccgctc aaccagaggg cgatcgagtc      2040
     ccagaagcag cttccagcac agggctgagt cgtcagtag                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page