(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE148

CP000435.PE148       Location/Qualifiers
FT   CDS_pept        156164..158641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0150"
FT                   /product="Chain length determinant protein family protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46364"
FT                   /db_xref="GOA:Q0IDT5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT5"
FT                   /protein_id="ABI46364.1"
FT                   /translation="MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEIDLR
FT                   ELWRALKRRKKIVGFTAAAVLVLSGVVTTYQRLFMPVYEGSFALLITDPISNEGGNNSA
FT                   ASSAASGTVFEQLARNTTQNDIPTLIEVLESPLLLAPIAKRFDVSENELAERINITTGG
FT                   AKRKEAEGVLKVSLTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGIAFLDLQAPAL
FT                   QAKADAIQGELAEFRRRHSLLEPAIEGTALKQREATLATQIFGFEAERSRLKRVRQDIA
FT                   SGSLSARGFQEAISTGSGGVVTGNQQSQGLAVSDADQSLLQQLLKVETELAEARSKFVN
FT                   NSSMVLSLEARLEQLQPLLRENQLEAVDAALGLNANRLATARAQERTLQDNFLKQPALI
FT                   KQYETLQTKLTLAQENLSGLVSARETFRLESAQSSVPWRVIDPPEIDPNPIKPSIPRNL
FT                   ALGAMLGLVAGVAAGLIRDRFDHVFHLPAEVKDDLNLPLLGHIPHVAFFKGVREDKRFL
FT                   LNELDQSSNNNATNAPESRKQDRYQRFFYQEAFRNLFTSLRFLNTERPLKAVALTSSLP
FT                   AEGKSLVNVLLAKTLAEMGQRVLLVDADLRKPQLHIRLGINNLQGLSNLITEDALHWRD
FT                   LCKQVPGYENWSVMTAGLRPPDPTRLLSSQRMHDLVQEITQSNDFDLVLFDTPPVLGLA
FT                   DASLVAEHCDGLMLLVSLNRVDRGLPQEAVNRIVSSGVPLLGLITNAVSTEEQSNQFGY
FT                   GKYGYGKYGYGRYGYGYGGYNSYSAALYANYADPEDSIDSSSEGAGKSLKASPTWREQL
FT                   RERSRRFMQWLDN"
     ttgtcaaacc tgatcgcccg accaggtcaa agccctgatc ttgttccgca aacgatccag        60
     gacgtgcagg taagagacct tggactcaac ctttcaaacc tgaaagcaga agcgagcgat       120
     gagatcgatc tcagggaact atggcgcgcg ctgaagcgca gaaaaaagat cgttggcttt       180
     accgctgccg cagttttagt gctgtctgga gtcgtcacca cctatcagcg cctgttcatg       240
     ccggtctatg aaggctcctt tgcgctctta attaccgatc ccatcagcaa tgaagggggg       300
     aacaactctg ctgcttccag cgccgcaagc ggaaccgtat ttgagcaact cgctcgcaac       360
     accactcaaa acgacatccc caccttgatt gaggtattgg agagcccact gctactggct       420
     ccaatcgcca agcgctttga tgtctccgaa aacgagcttg cagagcgaat caacatcaca       480
     accggtggtg cgaagcgcaa agaagctgaa ggggtgctca aagtgagcct caccggccga       540
     aaccccaaag aagatggcca actgctcgag gccatcagcg cggcctacct gcaaacagct       600
     ttgcaacagc gccagaaacg actcaccgat ggcatcgctt tcctcgattt acaggccccg       660
     gccttgcagg ccaaagcaga cgccatccag ggggagttgg ctgagtttcg aaggcgccac       720
     tccctgctcg agcccgccat tgaaggcact gccctgaaac agcgggaagc cacactggcg       780
     actcagattt ttggctttga agcagagcgc agtcgcttga aacgcgtgcg tcaagacatt       840
     gccagcggca gcctcagcgc ccggggattt caagaagcca tcagcaccgg cagcggtgga       900
     gtcgtaaccg gcaaccagca gtctcagggt cttgctgtca gcgacgccga ccaaagcttg       960
     ttgcaacaac tgctcaaagt ggaaaccgaa ctggcggaag cccgctcgaa atttgtcaac      1020
     aactcttcca tggtgctcag ccttgaggcc cgtctcgagc agctccaacc actgttgcgt      1080
     gaaaaccaac tggaagccgt ggatgcagcc ctcggcctca acgccaaccg cctcgccacc      1140
     gcccgggccc aggagcgcac cctgcaggac aacttcctga aacaacctgc tctcatcaag      1200
     cagtacgaaa cgctgcaaac caagctcaca ctcgctcaag aaaacctgtc tggactggtg      1260
     agtgccaggg aaaccttccg tctcgaaagc gcccagagtt ctgtgccctg gcgcgtgatc      1320
     gatccaccag agattgatcc caacccgatc aagccatcga ttccgaggaa cctggcccta      1380
     ggcgccatgc tcgggctcgt tgctggcgta gctgccggcc tgattcgtga tcgcttcgat      1440
     catgtctttc atctcccagc agaggtcaaa gatgatctga acctgcctct tcttggccat      1500
     attcctcacg tggctttttt caaaggggtg cgggaagaca aacgcttcct tctcaacgaa      1560
     cttgatcaat cgagcaataa caacgctacg aacgctccag agagccgcaa acaagatcgc      1620
     taccaacgtt ttttttacca ggaagcattc cgcaatctgt tcacatcact gcgtttcctc      1680
     aacaccgaac gaccgttaaa agccgtagct ctcacaagct cacttccagc agaagggaaa      1740
     tctcttgtga atgtgctgct cgccaaaacc cttgccgaaa tggggcagcg ggtactgctc      1800
     gtggatgcag acctccgcaa accacaactg cacatccgcc tcggaatcaa caatctccag      1860
     gggctctcca acctgatcac agaagacgct ttgcattgga gggatctctg caaacaggtc      1920
     cctggatacg aaaactggag cgtgatgacc gctggcctgc ggccaccgga tcccacgcgt      1980
     ttgctcagtt cacagagaat gcatgacctc gttcaggaga tcactcaaag caacgatttt      2040
     gatctggtgt tgttcgatac cccaccggtg ctgggcctgg ccgacgcctc ccttgtggcc      2100
     gaacactgtg atggcctgat gctgctcgtg agtctgaatc gcgttgaccg aggcttgccc      2160
     caagaagcgg tcaacagaat cgtctccagc ggcgttccct tgctgggcct catcaccaat      2220
     gccgtgagca ccgaggagca atccaatcag tttggctacg gcaaatacgg ctatggcaaa      2280
     tacggatacg gcagatatgg atatggatat ggcgggtaca acagctattc agcggccctc      2340
     tacgccaact acgccgaccc agaagacagc atcgactcga gcagtgaagg cgcaggcaaa      2400
     agcctcaagg catcaccaac atggcgagaa cagctacggg aacgtagccg tcgcttcatg      2460
     caatggctcg acaactga                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page