(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE161

CP000435.PE161       Location/Qualifiers
FT   CDS_pept        complement(176150..176392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0163"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45406"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS2"
FT                   /protein_id="ABI45406.1"
FT                   /translation="MRTTLELPDPLFALLKSRAEGEQITLKQHLQSYVEQGLMAPTHSA
FT                   RPTARSARQLPMVEGRLAFDFSTPSNVDLFDLHEP"
     atgcggacca cccttgagtt gccggatcct ctctttgcgc tgctcaaatc cagggccgaa        60
     ggcgaacaga tcacccttaa gcagcacttg cagagctacg tagagcaagg gctcatggca       120
     ccaacgcaca gcgcgagacc aacagcacgg tctgccagac agctcccaat ggttgaggga       180
     cgccttgctt ttgatttcag cactcccagc aacgtagacc tctttgacct gcacgagcca       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page