(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE173

CP000435.PE173       Location/Qualifiers
FT   CDS_pept        complement(184234..185064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45832"
FT                   /db_xref="GOA:Q0IDR0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR0"
FT                   /protein_id="ABI45832.1"
FT                   /translation="MNMLFYFMPPSVEIAKVVAQDPDVILFVDLESLGKQKRQGHLKTW
FT                   KSKHSITHVNDIREACPDTELLVRIDPLNINSQEQVDNVIRGGANAIMLPMFHDIDEVK
FT                   AIVELVNGRTRLVPLFETISSLKILEDAIRLYDIKDLHFGLNDLSLDLGYNFLFEVISN
FT                   GILEESCSFLRSNGIDFGIGGVARSQEGVISPEYLLGEHVRLGSTRVILSQTFHRNPKD
FT                   LNAMADDMNFSEELSKLKKIYSNFSKCSDAELKTNQLMTNSRIKDVSNLIHKSK"
     atgaatatgc tattttattt tatgcctcca agtgtagaga tcgctaaggt cgtagcacaa        60
     gatcctgatg tcatcttatt cgtagacctg gaatccctag ggaagcaaaa aaggcaaggg       120
     catcttaaaa cttggaaaag caagcatagt attacacatg ttaatgatat tagggaagcc       180
     tgtcccgata ctgaactgct tgttcgcatt gaccctctta atatcaactc acaagaacag       240
     gtagataatg ttattagggg gggagctaat gcaattatgt tacccatgtt tcatgatatc       300
     gacgaagtca aagcaatcgt agagcttgtt aatggacgga ctagattagt tccactcttt       360
     gagactattt catctcttaa gattctcgag gacgcaatca gattatacga tatcaaagat       420
     cttcattttg gccttaatga tttatcattg gatcttggtt acaattttct attcgaggtg       480
     atttcgaatg ggattcttga ggagagctgc tcatttctta gatcgaatgg tatagatttt       540
     ggaataggag gggtagcacg ctctcaagaa ggtgtcattt ctcctgaata tctcttaggc       600
     gaacatgtga gactgggctc tactcgggta atattaagtc agacattcca tagaaaccct       660
     aaggatctca atgcgatggc tgatgacatg aacttctcag aagaactcag caagctcaaa       720
     aagatataca gtaatttcag caaatgctct gatgctgagc tgaagacgaa tcagctcatg       780
     acaaattcta gaataaaaga tgtctcaaat ctaattcata agtcaaaatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page