(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE178

CP000435.PE178       Location/Qualifiers
FT   CDS_pept        complement(190550..191539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47679"
FT                   /db_xref="GOA:Q0IDQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ5"
FT                   /protein_id="ABI47679.1"
FT                   /translation="MIALAFINATRIRSGYFDLNEINLQDGAFIQIKQTFEFIQSGGAV
FT                   TRALENPIFVTHLVRVAIFIPFSYLGSLGHGQGLEYVLLILISLPVVMRYYKRSNDIIY
FT                   LAPLVLPFLISYRSFLAALAIGYVVIAITSKGNILFLLFGVTLSLLSTAVMVQSSLLIL
FT                   IYRKKISCLLRNNPVAIVPLIAFLGITLLVTLVKIQGFVGGLDGYTSEYGSDGIQSAIT
FT                   RSTLVIGLAKGSLRGYLSLAIALLLIISLVRLGNSRNKELKTYFRILSCLAPGLLFEGL
FT                   GIVSILFPILWMVRGVHLIELGEFNRGYIRKSVKSCKATYTRDDCTSV"
     ttgattgcat tagcattcat taatgcgacc agaattagat caggatattt tgaccttaac        60
     gaaataaacc tgcaagatgg agcttttata caaataaagc aaacatttga gtttattcaa       120
     agcggtggtg cagttacaag ggcactagag aatcctatct ttgttactca tttggtaaga       180
     gttgccatat ttattccatt ttcatatctt ggcagtctgg gacatggtca ggggcttgaa       240
     tatgtactac taattcttat aagcttaccc gtggtaatga gatactacaa gaggtcaaat       300
     gacataattt atttggcacc tctagtactt ccattcctaa taagttatcg atcgtttctt       360
     gctgctcttg ctattggtta tgtagtaata gcgataacaa gcaaaggcaa tatattgttt       420
     ttattatttg gggtaacctt gtctctttta agcacggcag ttatggtgca gagctcgtta       480
     ttgatcctca tttaccgtaa gaaaattagc tgccttctaa ggaataatcc agttgcaata       540
     gtgccattaa ttgcttttct gggaataaca ttactagtaa ctcttgtaaa gattcaaggt       600
     ttcgtgggtg gcttggacgg ttacacgtct gagtacggct cggatggtat tcagagtgca       660
     attacaagaa gcactcttgt tattggttta gcaaagggca gtctgagagg atatttatca       720
     ctagcaatag ccttattatt aataatcagt ttagtgcgcc ttggcaactc tcgtaataaa       780
     gagcttaaga cttattttag aatcttgtcc tgcctagcac ctgggctttt gtttgaaggg       840
     cttggcatag tctcgatatt gttcccaatc ctatggatgg ttagaggagt gcaccttatt       900
     gagctgggtg aatttaacag agggtacatc agaaagtccg ttaaatcgtg caaggcaact       960
     tacaccagag atgattgcac aagtgtataa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page