(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE184

CP000435.PE184       Location/Qualifiers
FT   CDS_pept        complement(196147..198279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45968"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP9"
FT                   /protein_id="ABI45968.1"
FT                   /translation="MVKQENSKRKIAKLALACSSPGGAALIKETIGYLAKKRDIEIEVV
FT                   MVEEPAWRILENVCKLNNIRAAISTNARYTKHESDKKQEYMKWVLETIGDAQIDAVITG
FT                   LSGLDMGVDETLQLIGSRQRKIRYTLQDTPGWVVDGIAGPSPTYFVQIAGKEKEMTEKG
FT                   VHRSICVGELKMKEMKYKAERLLKKVGQNEITTNRVLFIGQPLWQLQGYRKTLEKLHSV
FT                   VADLGKDGIDYVSHPLEGKEQAIASGLVKVTSRGLLELVLEYKYIVTCFSTGLKEAAMI
FT                   NMAAKRKLPRLIYAIGEKDVRASYVENGQSISELVKDSWFAEVIDRELTLGDFKTEIWG
FT                   NKTIEFSEPKTEEIYKTIVRDYKKRLFLPKNYAADSQLDTSRRQLGSSHSWAEEIREAL
FT                   RKCGLGEANSEIRRLSTLHDESETVYIRGNTKESGNIFIKLIDTREVEQTKNALLMVQE
FT                   IGEGCAQVETVLTKDPVYIETKNKYMAVTQWIDSTEIDCEDEDNLKKIGSALGLLHKRM
FT                   KTLVFKRELAIERQRWIVDAWHEVAKTDLLEKKCSTLSKKIKEEISKRANRVSRETNKQ
FT                   FIHGDLNKGNILCTRQGGIIFIDFEEATSSWLPFYVDLAIVIERLCMLSGRNSIKRCRV
FT                   LLSEYFKVVEWRLPRVEALNDGRAYAIARSFGILSQSRLYGLDWPEYEWTKFCKLTKHM
FT                   IDEKKILRDLSVDFTN"
     atggtgaaac aagagaatag taagcgaaaa attgccaagc tagcactagc atgctcctcc        60
     cctggtggag cagcattgat aaaggaaact attggctact tagcaaagaa acgagacata       120
     gaaatagagg tggtaatggt cgaagaaccg gcgtggagaa tattggagaa tgtttgcaag       180
     ttaaataata taagagcagc aatttcaacc aatgcgagat acactaagca cgaatctgac       240
     aagaaacagg agtacatgaa atgggtcctc gagacgattg gggacgcaca aatagatgct       300
     gtaataacag ggctaagcgg tttggatatg ggagtagatg agacattgca gttaattggt       360
     tctagacaaa gaaaaatccg ctacacgctt caggatacgc ctggttgggt tgtggatggc       420
     atagcaggtc catcaccgac ttacttcgta cagattgcgg gaaaggaaaa agaaatgact       480
     gaaaagggcg tacacagatc gatttgtgta ggagaattaa aaatgaaaga gatgaagtac       540
     aaagccgaga gactgttaaa gaaagttgga cagaatgaaa ttacgacaaa cagagtattg       600
     tttataggtc aaccactatg gcaactacaa ggttatagaa aaaccctaga aaaactccat       660
     agtgtggtgg cagacttagg gaaggatgga atagactacg taagccatcc tcttgaagga       720
     aaggaacagg caattgcaag tggattagta aaagtaacaa gcagaggcct actagaacta       780
     gtgcttgaat acaaatatat agtaacctgc ttttcgaccg gactaaagga agcggctatg       840
     ataaatatgg cagcaaagag aaagttaccc agactaatct atgcaattgg agagaaggat       900
     gtcagggcgt cgtatgtcga aaatggccag tcaataagcg aactagtcaa agatagctgg       960
     tttgcggagg ttatagacag agagctaacc ttaggagatt tcaagacgga gatatggggt      1020
     aataagacga ttgaatttag cgagccaaag acagaagaga tctacaagac gatagttagg      1080
     gattacaaaa aaagattatt cttgccaaag aattatgcgg cagacagcca gcttgataca      1140
     agccgaaggc aattagggtc aagtcacagt tgggcggaag aaataaggga ggcactaaga      1200
     aaatgcgggc tgggagaagc caatagtgaa atcagaagac taagcacatt gcatgatgaa      1260
     tccgagactg tgtacataag aggcaacaca aaagagtcgg gcaatatatt cataaaacta      1320
     atagatacca gagaggttga gcaaactaaa aatgcactat taatggttca agagataggg      1380
     gaaggatgtg cacaggttga aacggtattg acaaaggatc ccgtatacat agagacaaaa      1440
     aacaaatata tggcagtgac gcagtggatt gacagcacag aaatagattg cgaagacgag      1500
     gataatctca aaaaaatcgg cagcgcactt ggtttgcttc ataagagaat gaaaacctta      1560
     gttttcaagc gggagttagc aatcgagaga caaagatgga ttgttgatgc ctggcacgaa      1620
     gttgctaaaa ctgacttgct agaaaaaaag tgcagtacgt tgtcaaagaa aatcaaagaa      1680
     gaaatcagca aacgcgccaa cagagtaagc agagaaacga ataagcaatt tattcatggg      1740
     gatttgaata agggcaacat cttatgtaca aggcaaggag gtataatatt tatagatttt      1800
     gaggaggcca cgtcgagttg gcttccattt tatgtagatc tggctattgt tattgagaga      1860
     ttgtgcatgt tatccggtag aaacagcata aaaagatgca gggtattact tagtgaatac      1920
     ttcaaagtag ttgaatggag attaccaaga gttgaagcgc tcaacgatgg cagagcatac      1980
     gcaattgcca ggtcctttgg tatattatct caatctagac tatatggttt agattggcca      2040
     gagtatgaat ggacaaagtt ctgcaagctt actaagcata tgatagatga gaaaaaaatc      2100
     ttgagagact tgtcagtaga ttttactaat taa                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page