(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE188

CP000435.PE188       Location/Qualifiers
FT   CDS_pept        200540..200671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46355"
FT                   /db_xref="GOA:Q0IDP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP5"
FT                   /protein_id="ABI46355.1"
FT                   /translation="MRRPCFDRQGIIQAYVGFVVALIAQLSSYDHISIPAGINLQLQ"
     ttgcgccgcc cttgctttga tcgccaggga atcatccagg cttacgtggg tttcgtggtt        60
     gccttgatcg ctcagctcag ctcttatgac cacatctcca tcccagcagg catcaacctg       120
     cagcttcagt ag                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page