(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE194

CP000435.PE194       Location/Qualifiers
FT   CDS_pept        205439..205621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22124.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45725"
FT                   /db_xref="GOA:Q0IDN9"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN9"
FT                   /protein_id="ABI45725.1"
FT                   /translation="MASAAPILPGATVTVVDTRSIYAGYTGFVQRISGDRAAVLFEGGN
FT                   WDKLVTMRLSDLSAA"
     atggcctccg ccgctccgat cctgcctggt gccacggtca ccgtggttga tacccgttcg        60
     atctatgccg gctacacggg atttgttcag cgcatcagtg gtgatcgcgc agccgtgttg       120
     tttgagggcg gcaattggga caagctcgta acgatgcgcc tcagcgatct cagtgccgcc       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page