(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE195

CP000435.PE195       Location/Qualifiers
FT   CDS_pept        205611..206435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0197"
FT                   /product="cation transporter, voltage-gated ion channel
FT                   (VIC) family protein"
FT                   /note="identified by match to protein family HMM PF00520;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46223"
FT                   /db_xref="GOA:Q0IDN8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN8"
FT                   /protein_id="ABI46223.1"
FT                   /translation="MPPDAMNLRLRFRRVVLDADTRAGRIYNLVIFGTILASVAGLLVE
FT                   PTPTWIAASDQAPDWTNVLERICLGVFIADFLLHLWVTPKPSNYLFSFYGLIDFSAVLF
FT                   FFIPQISSGLILWIFKFGRVLRVFKLLRFLDEAQLLGNALKASARRIGVFLFFVVMAQV
FT                   VLGYLMVLVESSHPQTQFQTVGQGVYWAIVTMTTVGYGDIVPQTVLGQLLAAGVMLLGF
FT                   GIIAIPTGIITVETMEQVRRGGRSCTSCGASAHHKKALRCDQCGSILPPLSA"
     gtgccgcctg atgcgatgaa tctgcgtctg cgctttcggc gcgttgttct tgatgccgat        60
     actcgggctg gccgcatcta caacctggtc atttttggca cgattcttgc cagtgttgct       120
     gggctcttag tagaacccac gcctacctgg atcgctgcct ctgatcaagc acccgattgg       180
     acgaatgtcc tggagagaat ctgcttagga gtctttatcg cagacttcct tttgcatttg       240
     tgggtcacgc ctaagccgtc taattatctg tttagttttt acggcttaat tgatttttca       300
     gccgttctgt ttttttttat tccccagatc agcagcggtc tcatcctttg gatttttaaa       360
     ttcgggcgag tcctgcgtgt gttcaaactg ctgcgctttc tcgacgaagc tcagttgctc       420
     ggcaatgcct taaaggccag tgcacgccgc atcggcgtgt ttttgttttt tgtggtgatg       480
     gcccaagtgg tgctgggtta tctcatggtt ttggtggaaa gcagccatcc acaaactcag       540
     ttccagaccg ttgggcaagg ggtgtattgg gccatcgtca ccatgaccac cgttggctat       600
     ggagacatcg ttccccagac agtgctcgga caattgctcg ctgccggcgt gatgctgctg       660
     ggctttggaa tcattgccat ccccacgggg attatcaccg tggagaccat ggagcaagtg       720
     cgtcgcggtg gccgtagctg cacgagttgt ggtgcctcag ctcatcacaa aaaagcgctg       780
     cgttgtgatc agtgtggatc gatcttgccg cccctatcgg catga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page