(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE197

CP000435.PE197       Location/Qualifiers
FT   CDS_pept        complement(206841..207083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0199"
FT                   /product="prevent-host-death family protein subfamily,
FT                   putative"
FT                   /note="identified by match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47678"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN6"
FT                   /protein_id="ABI47678.1"
FT                   /translation="MLVNMLDAKSQLSRLVKAALAGEEVIIASHGKAQVKLVPCAAATG
FT                   LKEPGSLSALSLQASHVDEAFGEAVDQQVAQLFNG"
     gtgctggtca acatgttgga tgcaaaaagc cagctctccc ggcttgtgaa agcagccctc        60
     gccggagaag aggtgatcat tgccagtcat ggcaaggctc aagtgaagtt agttccctgc       120
     gctgcggcga ccggcttgaa ggagcctgga agtctttctg ctctttctct tcaggcatcc       180
     cacgtggatg aagcgtttgg cgaggccgtg gaccagcagg ttgcccaact attcaacggt       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page