(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE2

CP000435.PE2         Location/Qualifiers
FT   CDS_pept        1348..2148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45445"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE81"
FT                   /protein_id="ABI45445.1"
FT                   /translation="MTVPDQLLLSDLLHHRVRCDLGLDHGPGVMAWMHPPVHRLLGWVS
FT                   RPSALRTSRDVWRLDQCRGFDDQQVFVKGAPAEADQITLDRLPTLLDADLLNADGERVG
FT                   IIADLAFLPASGQISHYLVARSDPRLPGTSRWRLLPDRIVDQQPGLVSSAIHELDDLPL
FT                   ARASVRQDFLQRSRHWREQLQQFGDRAGERLEGWLEEPPWDEPPAVSDVASSYSSTAAP
FT                   TVDPLDDWDDGDWTDAPRVERGRSVRNDPTDRNDWPDHEEDPWV"
     ttgactgttc cggaccagct ccttttgagc gatctgttgc accaccgggt gcgctgtgat        60
     ctaggccttg atcatggacc aggggtcatg gcttggatgc acccgcctgt gcatcgtctg       120
     ctcggctggg tgagtcgtcc gtctgcattg cgtacaagcc gggatgtttg gcgtcttgat       180
     caatgtcgtg gattcgacga tcagcaggtc tttgtcaagg gggctcccgc agaagctgat       240
     cagatcacct tggatcggtt gccaaccctg ctggatgccg atcttctaaa tgccgatgga       300
     gagagggtcg gcatcatcgc tgatttggct ttcctgccag cgagcgggca gatcagtcat       360
     tacctcgtgg cacgcagtga ccctcgcctg cctggaacca gtcgttggcg cttgttgcca       420
     gatcgaatcg ttgaccaaca gccaggcttg gtgtcttcgg ccatccatga actcgatgat       480
     ttgcctctgg ctcgggccag tgttcgtcag gattttcttc agcgctccag gcactggcgg       540
     gaacagctgc agcagtttgg agatcgcgct ggcgagcgcc tggagggttg gttagaggaa       600
     ccgccttggg acgagccccc cgcggtttct gacgttgcct cttcctattc gtcaacagca       660
     gcgcccacgg tggacccact cgatgactgg gatgatggtg attggaccga tgcccctcgg       720
     gttgagcgtg gccgttcagt acgaaatgat ccgacggatc gaaatgattg gcctgatcac       780
     gaggaagatc cttgggtctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page