(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE201

CP000435.PE201       Location/Qualifiers
FT   CDS_pept        209383..209838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22121.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45175"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN2"
FT                   /protein_id="ABI45175.1"
FT                   /translation="MPDEPCQCPDCQRFYREHDRLIRESPTLRQQQELSWAALQAFRTL
FT                   SGRVLEDLQKEHGTPSADSQTHATPIGGGEEPADAIHQAMADLENINAHLFSIEALMER
FT                   IFDVRVPDDIEQKFRELAGELAPDPLNADRLRLNRLLHQTPDLPDRG"
     ttgcctgatg agccctgtca atgtccggac tgtcaacgct tttaccgtga acatgaccgt        60
     ctgatcagag agtcaccaac attgcgtcag cagcaagagc tgagttgggc ggcccttcaa       120
     gcgtttagaa ccctgtctgg tcgtgttttg gaggatctgc agaaagaaca cggcaccccg       180
     tctgctgatt cccaaaccca tgccactcca atcggtggtg gtgaagagcc tgctgatgcc       240
     attcatcaag ccatggctga tctggaaaat atcaacgccc atctcttttc aattgaagcg       300
     ttgatggagc gcatctttga tgtgcgtgtg cccgacgata ttgaacagaa atttagggag       360
     ttggccggcg agctcgcccc agaccccctc aacgctgatc gcttgcgttt aaatcgcttg       420
     ctgcaccaaa cccctgatct acctgatcgc ggctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page