(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE210

CP000435.PE210       Location/Qualifiers
FT   CDS_pept        complement(219448..220827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0213"
FT                   /product="Fe-S oxidoreductase"
FT                   /EC_number="1.1.3.15"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45719"
FT                   /db_xref="GOA:Q0IDM3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM3"
FT                   /protein_id="ABI45719.1"
FT                   /translation="MASLTPSSSASEHQQADSGQNRPMAFVDPSDPCVHCGFCLPTCAS
FT                   YRVLGTEMDSPRGRIHTLKAIEAGELELDATVASHFDSCLGCFACVSACPSGVRYDQLI
FT                   EATRPKLNQPELRSSWQTSFRQLLLLVLPYPNRLRALLQPLRAYAGTGLQRFTRRSGLL
FT                   KLLGPQLEAMESLLPALPAEGFSDRLPRVNPAQGEQRGRVGLVLGCVQRCFDPGVNEAT
FT                   VAVLQANGFEVVIPADQGCCGAVSHHQGQLQQTQELASALVRSFRDEDLDAVLVAASGC
FT                   GHTMKAYGELLDGEDNFSAPVLDVHEFLANRGLSESFRQALTPLPCTVAYHDACHMIHG
FT                   QGIAAQPRDLLRSIPQLQLKEATEAGVCCGSAGIYNLVQPDEAAELGQLKANDLTSTGA
FT                   EIVASANIGCSLQLRRHLRSEGPDVCHPMELLARSARLSPAPAPTTGGQDSSATPPQQH
FT                   P"
     gtggcttcgc tgacgccatc atcgagcgct tctgagcacc aacaggccga ttcaggccag        60
     aatcggccta tggcttttgt cgacccaagc gacccctgcg tgcactgcgg attttgtttg       120
     cccacctgcg ccagttatcg ggtgctgggc acggagatgg attccccccg cgggcgcatc       180
     cacaccctca aagcgatcga ggctggagag ctggaactgg atgccacggt ggcaagccat       240
     tttgatagct gcttgggctg cttcgcttgc gtgagcgcct gtccatccgg cgtgcgctac       300
     gaccagctga ttgaagcgac ccgcccaaaa ctcaaccaac ctgagctccg cagcagctgg       360
     caaaccagtt tccggcagct gttgcttctg gtgctgccct accccaatcg cctgcgcgca       420
     cttctccagc ccttacgcgc ctatgcaggc accggactgc agcgtttcac tcggcgatca       480
     gggctattaa agctgcttgg cccgcaactg gaagcgatgg aatcgctctt gcctgccttg       540
     ccggccgagg ggttttctga tcgcttaccg cgggtgaatc cggcacaagg cgaacaacgc       600
     ggccgggtgg gcttggtgct tggttgcgtg caacgttgct ttgatccagg agtgaacgag       660
     gcgaccgtgg ccgtactgca agccaatggc ttcgaagtgg tgattccagc cgatcaaggc       720
     tgctgcgggg cggtgagcca tcaccaaggc caactccaac aaacccagga gctggcaagc       780
     gcattggtgc ggagtttccg cgatgaagac ctggatgccg tgctagtggc cgcctccggt       840
     tgcgggcaca ccatgaaggc ctatggggag cttctcgatg gcgaggacaa cttcagtgcg       900
     cccgtgttgg acgtgcacga attcctggcg aaccgggggc tgtccgagtc gtttcggcaa       960
     gctctcacac cgctgccctg cacggtggct tatcacgacg cctgccacat gatccatggc      1020
     caggggattg cagcccagcc cagagacttg ctgcgttcca ttcctcaact gcagctcaaa      1080
     gaagccacag aagccggtgt gtgttgcggg agtgccggca tctacaacct ggtgcaaccg      1140
     gacgaggccg ccgaactcgg ccaactcaaa gcgaacgacc ttacaagcac tggggcagag      1200
     atcgttgcta gcgccaacat cggttgcagc cttcaactga ggcgccatct ccgctcagaa      1260
     ggtccggatg tatgccatcc catggagcta ctcgcccgct ctgccaggct cagcccggcg      1320
     cccgctccaa ccactggcgg gcaagacagc tccgccaccc ccccgcagca acatccatga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page