(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE212

CP000435.PE212       Location/Qualifiers
FT   CDS_pept        222342..222803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ00795.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46992"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM1"
FT                   /protein_id="ABI46992.1"
FT                   /translation="MNPVNAAAAVHSVALAQALASSITLVRRQFPAAQPNLSPWRDDPL
FT                   TRHWDEAATLDLAFHFPGWSPRLQCRSLLLQLRFNSEPWEMDMSCPSLLGVVMRGMTFD
FT                   GERWRLATLGDWLPAGPHLPQRDQVEQLQLICREMFEVFEHGVPNHTSS"
     atgaaccctg tgaatgcggc ggcagctgtc cacagcgtgg ctttggccca ggccttggcc        60
     tcaagcatca cactcgtgcg caggcaattt cctgctgcgc agccgaatct gagcccatgg       120
     cgcgatgacc ctctcactcg gcattgggac gaggccgcaa cgttggattt ggcctttcat       180
     tttccaggct ggagcccgcg gctgcaatgt cgcagtttgt tgctgcaatt aaggttcaat       240
     tctgagccgt gggaaatgga catgtcttgc ccatccctcc ttggagttgt gatgcgtggc       300
     atgacttttg acggcgaacg ctggcgattg gcaacattgg gagactggtt gccggctggc       360
     ccccacctac cccaacgaga tcaggtggag cagctgcagt tgatctgtcg agagatgttt       420
     gaagtgttcg aacacggtgt gcccaatcac accagttctt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page