(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE216

CP000435.PE216       Location/Qualifiers
FT   CDS_pept        224897..226576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0219"
FT                   /product="ATP-binding ABC transporter family protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47311"
FT                   /db_xref="GOA:Q0IDL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL7"
FT                   /protein_id="ABI47311.1"
FT                   /translation="MARLVGLLAGQRLQDKIPGINVFGGGLLDQAGWIISLLILAFWIA
FT                   SAVRFAVSLMQSLLSAEIWNDLVNSVYSTLMRQDYEFFVSGKSTGIAIQFNRIFSNISK
FT                   NIVAPLITSAGSLVSIGSLMVGIVFILGIRALMIFMLMLVAYILASRIIIPYLRLATKQ
FT                   RIRYKKKISMLMAESIHSMREVQLYGAEDFFSKRFSSDGRIAKRYDRISRLLPDVPRLI
FT                   IEPAGITILFVIGLGPAIIQGDSQAIRQVAPELSVILIALLRISGPLQSLFKGINQLRG
FT                   GLPQVKEALELLELVPVRSMLSSQGVPSPSGLMPRRFIQLESVDFHYELSDRKVIDGVD
FT                   LMIPVGSRIALVGSTGSGKTTLAHLLLGLYHPTQGALCLDGIPVTRQELPAWQGNCSFV
FT                   PQNVRLSNGSVRDNVAFGRESDEIDDDRVWAALESAQFDDVVATMPYGLYTMVGDDGAK
FT                   LSGGQRQRLALARAFYREAKVLVLDEATSALDNKTEHDVMQALDIVGRRCTTIVIAHRL
FT                   STVKKCDRIYQLEQGKIIASGAFADLCNSSNSFREMNLFDGS"
     atggcaaggc ttgttggcct acttgctggg cagagattgc aggacaaaat tcctggaatt        60
     aatgtatttg gaggtggttt gttagatcaa gcaggctgga ttatttctct tttgatccta       120
     gctttctgga ttgcttctgc tgttcgcttt gcggtgtcat tgatgcaaag tcttttaagt       180
     gctgagatat ggaatgatct tgtaaacagt gtttatagta ctctcatgcg tcaggattat       240
     gaattttttg taagcggtaa gtcaacaggt attgcaattc agtttaacag aatttttagc       300
     aatatttcta agaatattgt tgctcctctc atcacaagcg ctggaagcct tgtttccatt       360
     ggatctttga tggttggcat tgtatttata ttggggataa gggcattgat gatatttatg       420
     ttaatgctag ttgcgtacat acttgcatcc agaattataa taccgtattt gcgtttagcg       480
     acaaaacaga gaattcggta caagaaaaaa atatcaatgt tgatggctga atctatccat       540
     tcaatgaggg aggttcagtt atatggggct gaggattttt tttctaagcg cttttctagt       600
     gatggcagga ttgctaagcg ctatgaccgc ataagtaggt tattgcctga tgtgcctcga       660
     ttgattattg agcctgctgg aattactatt ctattcgtca taggtcttgg gcctgcgata       720
     attcagggag attctcaagc tattcgtcaa gttgctccag aactttcagt catcctgatt       780
     gcgcttctgc gcatttctgg cccattgcaa tccttgttta aagggattaa ccaattgcgt       840
     ggtggattgc cccaagtgaa ggaagcgctt gagttgctgg agcttgtgcc tgtgcgctct       900
     atgctgtcat cccaaggagt tccgtctccg tctgggttga tgcctagaag attcattcaa       960
     cttgaatctg ttgattttca ttatgagctg agcgatcgaa aagtaatcga tggtgttgat      1020
     ttaatgattc ctgtcggctc tcgaatagcc ttagtcggaa gcaccggcag tggtaaaaca      1080
     actttagctc atttgctttt aggtttgtat cacccaactc aaggtgcgct ctgtctagac      1140
     ggaattcccg taacacgtca ggagcttcca gcctggcagg gcaattgctc gtttgttcct      1200
     caaaatgttc gtttgtctaa tggaagcgtt agggataatg ttgcttttgg tagagagtct      1260
     gacgagatag atgatgatcg tgtttgggct gcacttgagt ctgcgcaatt tgatgatgta      1320
     gtcgccacga tgccttatgg tctttacacc atggttggtg atgatggtgc caagctgtct      1380
     ggtgggcaga ggcaaaggtt ggcattggca agagcatttt atagggaagc aaaggttctt      1440
     gttttagatg aagcaacgag tgctcttgat aataaaactg agcatgatgt tatgcaggct      1500
     cttgatattg tcgggcgtcg ctgtactacg atagtaattg ctcatcgtct ttcaacagtt      1560
     aaaaaatgtg atcgtattta tcagcttgag caaggcaaaa ttattgcttc gggtgcattt      1620
     gctgatctat gtaatagttc aaatagtttt cgtgagatga atttgttcga tggctcctga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page