(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE217

CP000435.PE217       Location/Qualifiers
FT   CDS_pept        226619..228835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0220"
FT                   /product="possible glycosyltransferase family 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45286"
FT                   /db_xref="GOA:Q0IDL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL6"
FT                   /protein_id="ABI45286.1"
FT                   /translation="MNDVVIIATADWDHPIWTNKQHVARSLADLGNRVLYVESLGIRSV
FT                   QITRSSDWTKIKRRIFRALWPLRQVSPRIWVLSPLVIPGGSDGWSRRLNKLSLRLALAL
FT                   AQAHIGLRQPLLWTFNPLTRRYLNLKMFRSTVYHCVDRIQAQPGMPVELLDLEEKALCQ
FT                   ESQVVFTTAPCLQEGLQALNPATYLFGNVADAEHFAQALEPALPRPVDCPSSERPLVMF
FT                   IGAIDAYKLDMLMLEQLIQATPQWTYLLIGPIAETDSSTEISGLHRLPNVYFIGSRPYR
FT                   DLPAYLACADVALLPLQINDYTRHMYPMKFFEYLAAGCPVVATAIPSLHDQGDVAWLCD
FT                   PSCQSFKQSIQEALEGKGAPRQQRLERASMHTYQRRTEAMLECLDFHGLLLPMTGATTH
FT                   MPNARPLSCQALESLGVSLLVLLIGALRILNQNFLSGALRNAGLKRWSCNTRLLYLAAD
FT                   DAIRSGDMRDARHYMEGLWRENGQVLALHRLLLKPRRGQVVDQLALFETMMNSNVFPLH
FT                   FTGYCAVVLGDWSIEIKDPDLRDGCLNTLTTVITTLLDDPGTYHCLRPVHENRMQLLVS
FT                   AQLSRMRLLMAAQFWLELEACGPSLMRSIADYNPALIDPQSASRLTTNAVRCLAMEGLM
FT                   AWWTNDAQRFLASFSEVHRLVVAADSLSFDSDSLGGQTEAQAFAALMLKQLRGCLWRAD
FT                   LGQQRPGRGQLVGFVLLILNNHLNWKRSDKVQRLLKTLEQTKPA"
     atgaatgatg ttgtgataat tgctactgct gactgggacc atcccatctg gacaaataag        60
     cagcatgttg cgcgttctct agctgattta ggaaatcgag ttctttatgt cgagtcgctt       120
     gggatacgct cggttcaaat tactcgttct tctgattgga cgaagattaa gcggcggatt       180
     tttcgagctc tttggccatt gcgtcaagtg agtccaagga tttgggtgtt gtcgccactg       240
     gttatcccag gtggcagtga tgggtggagt cgtcgactca ataagttaag cctgaggttg       300
     gccttggctc ttgctcaggc tcatattggg ctgcgtcaac cattgctttg gacatttaat       360
     ccgttaactc gtcgttatct aaacctgaaa atgtttcgtt cgaccgtcta tcactgcgtc       420
     gataggattc aggcccaacc agggatgcct gttgaattgc ttgatttgga ggagaaagca       480
     ctctgccaag agtcccaggt tgtttttact acggcacctt gcctgcagga aggcttacag       540
     gctctcaatc cagcaactta tctatttggc aacgtggccg acgcggagca ttttgctcag       600
     gcgcttgagc ctgctttgcc acgaccagtc gactgccctt catctgagcg tccattggtg       660
     atgttcatcg gtgcaattga tgcttacaag ctcgatatgt tgatgctgga gcagttgatt       720
     caggccacgc cgcaatggac atatctgtta attggcccga tagcagagac cgactccagc       780
     acggagataa gtggcttaca tcgtctacct aatgtgtact ttattggaag tcgtccttat       840
     agagatctcc ccgcttattt ggcctgtgcc gatgttgcct tgttgccgtt gcaaattaat       900
     gactacacca ggcacatgta cccgatgaag ttttttgagt atctggctgc aggatgtcct       960
     gttgtggcga ctgctattcc ctcgttgcat gatcaaggtg atgtggcttg gttatgtgat      1020
     ccgtcttgtc agagctttaa gcaatcgatc caagaggccc ttgaaggtaa gggcgcccct      1080
     aggcagcaac gactggaacg cgcatccatg catacctatc aacgcaggac tgaggcgatg      1140
     ctggaatgtc ttgattttca tggtctgctg ctgcctatga cgggggcgac tacccatatg      1200
     ccaaatgctc ggcccctatc ttgccaagca ctggaatctt taggggtgag cttattggtt      1260
     ttgctgatcg gggctttgag gattctcaat cagaactttt tatctggggc tttaagaaat      1320
     gcaggcctga agcgatggtc gtgtaacaca cgtctgcttt atttggctgc agatgatgct      1380
     attcgctctg gagatatgcg agatgcacgt cactacatgg aaggtctttg gagagagaat      1440
     ggacaagtat tggctctcca tcgcctcttg ttgaagccca ggcgggggca ggtagtggat      1500
     cagttagccc tttttgaaac catgatgaat agcaatgtat ttcccctgca tttcacgggt      1560
     tattgcgctg tcgttcttgg tgactggtcg attgaaatta aggatccaga tttgcgtgat      1620
     ggctgtttga acactctcac gacggtgatt acaactttgt tggatgatcc cggcacttat      1680
     cactgtcttc gtccagttca tgagaatcgg atgcagttat tggtctcggc tcagctgtct      1740
     aggatgcgcc tgctgatggc agctcaattc tggctggagc tggaagcgtg cggtcctagc      1800
     ctgatgcgca gcatcgctga ctacaaccct gctttgatcg atcctcagtc ggctagccgg      1860
     ctgacgacta atgcagttcg ttgtctggcc atggaagggt tgatggcctg gtggacaaat      1920
     gatgctcagc gctttcttgc ttctttttct gaagtgcaca gacttgttgt cgcggcggat      1980
     tcgctttctt ttgactctga ttctctagga ggtcaaacag aagcccaagc ttttgctgcg      2040
     ctcatgctga aacaactgag ggggtgtttg tggcgtgcgg atcttggtca gcagcgccca      2100
     gggcgaggtc aattagttgg gtttgtgttg ttgattttga ataatcatct caactggaag      2160
     cgaagtgaca aagtacaacg gttattgaaa acattggagc aaaccaaacc agcttga         2217
//

If you have problems or comments...

PBIL Back to PBIL home page