(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE218

CP000435.PE218       Location/Qualifiers
FT   CDS_pept        228848..229990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0221"
FT                   /product="possible glycosyltransferase group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46319"
FT                   /db_xref="GOA:Q0IDL5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL5"
FT                   /protein_id="ABI46319.1"
FT                   /translation="MQIAFYIDSLKLGGAERVLLLWAGWCVQNNWHVTVITRQGLEQDV
FT                   YPLPTGVQRRVEAPLPWGLERFGWWAFPLRVWSLRLLLKELGPLDCAVGVTTLPAIKLL
FT                   LAAHGGRIRCLVSERNFPPAKRPALPWRLLRRFTYPWADLHLVQTSETGDWLKRHCGAH
FT                   RQRLMPNPVTWPLPDRDPRLDPDDWLDADVPMLLAAGTKAHQKGFDQLMQVFALLALRH
FT                   PTLRLVILGLGNSKYHGCDQQAMLRGLLPEDGALQRQLLFPGMVGNMSSWYERATIFVL
FT                   PSLYEGFPNVLLEAMAAGCACVARDCDTGPRDLIDQNHNGVLLPSEATSNMWAETLDEL
FT                   LTQPVRRRRLADAAKGVRERYAESVLRCDFLESLKGLVYG"
     atgcaaatcg ctttttacat cgattcactt aagcttggtg gtgccgagcg tgtccttttg        60
     ctttgggctg gttggtgtgt gcagaacaac tggcacgtca ccgtaattac ccgtcaggga       120
     ctcgaacagg atgtgtaccc cctccccaca ggagtgcagc gaagggtcga ggcccctttg       180
     ccctggggat tagaacgctt tggttggtgg gcctttcctc ttcgtgtatg gagcctgcgt       240
     cttctgctca aggagctggg cccacttgac tgcgcggtgg gtgtgaccac cttgccagct       300
     atcaaattgc tgcttgcggc acatgggggt cggattcgct gcttggtctc ggagagaaat       360
     ttcccccctg caaagcgtcc tgcgctgcca tggcgtttgc tgcgccgctt cacctatcca       420
     tgggccgact tgcatttggt gcaaacctca gaaaccggtg attggttgaa gcgacactgc       480
     ggagctcacc ggcagcggct tatgcctaat cccgtgacct ggccactacc ggatcgagac       540
     cctcgattgg atcctgatga ctggcttgat gccgacgtcc caatgttgct ggccgccgga       600
     accaaggcgc atcagaaagg atttgatcaa ctgatgcaag tgtttgcctt gctggccctg       660
     aggcatccaa ctctgaggtt ggtcattttg ggattgggca attctaaata tcacggctgt       720
     gatcagcagg ccatgttgcg gggcctcttg ccagaggatg gggccctaca gcgtcagctg       780
     cttttccctg ggatggttgg aaatatgtcg tcctggtatg aaagagcaac gatttttgtt       840
     ttgccatctc tttatgaggg cttccccaat gtgttgttgg aagcaatggc tgctggctgt       900
     gcctgtgttg ccagagattg tgataccggc cctcgagatc tgattgatca gaatcacaac       960
     ggggtgttgc tgccatccga ggctacttcc aatatgtggg ctgaaacgct ggatgagcta      1020
     ctcacgcagc ctgtacgtag acgacgtttg gcagatgctg ccaagggagt gcgtgagcgc      1080
     tatgccgagt ccgtattgcg ttgtgatttc ttggagtcct tgaaggggtt ggtctatgga      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page