(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE219

CP000435.PE219       Location/Qualifiers
FT   CDS_pept        229983..231254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0222"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by similarity to SP:Q9R9N1; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45426"
FT                   /db_xref="GOA:Q0IDL4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL4"
FT                   /protein_id="ABI45426.1"
FT                   /translation="MDDLWVVLPHLGAGGAQKVALLAAEHFAAQGLRVRVITMIHGHPV
FT                   LHALPDGVRHQELSPQLEVLKPWLGDGSNRSLLARGSRYLIANLIKVYRFMIRAQMVLI
FT                   GPWLESHIRPGSSGLAAELFQLGTTTLLGDRLLQFRNLVEQEQPRRILALLTRTNIVCC
FT                   LACWDLPVHVVVSERNDPARQRLGTFWALLRRLCYRRADVVTANTDGVLKALSRIGTWQ
FT                   RLELLPNPLPFGVISSAENGSERDLEVLAVARLKIQKGLDLLIRAFASIPEVRRLGWCL
FT                   TVVGDGPERSSLENLVTKLGIDGVFFEGFRSDPQTFMQRAAIFALPSRFEGMPNALLEA
FT                   MAAGLPCVVSDASPGPLEMITDGVNGLVVPHEDWPALAKKLEMLMEDQILRFRLGEAAR
FT                   QKLRSLDWSVVEPHWRSVLALPKL"
     atggatgatc tatgggtggt gctacctcat cttggggcag gaggtgccca gaaggtggct        60
     ctgctggcag cggagcattt cgctgctcag gggttgcgag ttcgggtgat cacgatgatt       120
     catggtcatc ccgttctgca tgccttgccg gatggagtga ggcatcagga attgagccca       180
     cagctggagg tcctgaaacc ttggctcggc gatggttcca accgttcttt gctggccaga       240
     ggaagtcgct atttgatcgc caatctgatc aaggtgtaca ggttcatgat cagggctcag       300
     atggttttga ttggcccttg gttggagtcg cacattcgtc cgggttccag tggtttggcc       360
     gctgaattgt ttcaactagg caccaccacc ctgctcggtg atcggctcct gcagtttcga       420
     aatctggttg agcaggagca accgcgcaga attttggcgt tgctcacacg caccaacatc       480
     gtgtgttgtc tggcttgttg ggatttgccg gtgcatgttg tggtctctga gcggaatgat       540
     ccggctcgac agcgacttgg aacattttgg gcgctgttac gacgcctctg ttaccgccgt       600
     gcggatgtgg tcacggcaaa tacagatgga gttttaaagg cattgagtcg gattggaacc       660
     tggcaaagac ttgagttgct ccctaaccca ttgccctttg gggtgatatc aagtgctgag       720
     aatggcagcg agcgcgactt ggaagtgttg gctgtcgcac gcctgaagat acagaagggt       780
     ttggacctgt tgattcgtgc ctttgcgtcc attccagaag tccgccggtt gggttggtgt       840
     ctcaccgtgg tgggggatgg gccagaacga agttctctgg aaaacctcgt caccaaatta       900
     ggaatcgatg gtgttttttt tgaggggttt cgctccgatc cacaaacttt catgcaaagg       960
     gccgcaattt ttgctttgcc atctcgtttc gagggcatgc ccaatgcttt gttggaagcg      1020
     atggccgccg gcctaccttg cgtcgtcagc gacgcatcac ctggcccgtt ggaaatgatc      1080
     accgatggtg tgaatggcct tgtggttccc catgaggatt ggccggcgtt ggcaaaaaag      1140
     cttgaaatgt tgatggaaga tcagattctc cgctttcgtc tcggtgaggc tgctcgtcag      1200
     aagctgcgct cactggattg gtcagttgtt gagcctcatt ggcgctctgt gctcgcattg      1260
     ccgaagcttt ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page