(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE220

CP000435.PE220       Location/Qualifiers
FT   CDS_pept        231221..232429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0223"
FT                   /product="Glycosyl transferase, group 1"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47629"
FT                   /db_xref="GOA:Q0IDL3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL3"
FT                   /protein_id="ABI47629.1"
FT                   /translation="MALCARIAEALMSGTELNNQRLLVFAPTRRALSETFIRANLEGLP
FT                   FELSAYFGDEFQGKRPLALAYSFGITLSKVLTRLHLLRLAGLPASLVAWCLIQKHRPDL
FT                   VLAEFGFEAVRVMEAAVWAKVPLVAHFRGSDASAHDRLGLLEGRYRRLLGVVSGVIVKS
FT                   RPMAQTMERLGADPAHILISPSGANAQLFRGGNPAIAPPVLLAVGRFVAKKGPLQTVRA
FT                   FGRCSEQGGTAMKTAELWMVGDGPLLVAAQALVIQLGLQNRVRFLGPKPPVAVAALMRE
FT                   VRAFVQHSCVAPDGDSEGSPVSVMEAQLSGLPVISTFHAGIPEVVIDQTTGLLVQEGDE
FT                   RAMADCMIELLLDPSRAEALGNAGRNRVLRHYTIDHHLRDVTAFLRARMPMSFVGQELI
FT                   KHV"
     ttggcgctct gtgctcgcat tgccgaagct ttgatgtcag ggaccgaact caacaatcag        60
     aggttgcttg tatttgcgcc gactaggcgt gccctaagtg agacctttat tcgggccaat       120
     ttggagggtc tgccctttga actctctgcc tatttcggag atgaattcca aggcaagaga       180
     cctcttgcct tggcctattc cttcggcatc accctgagca aggtgctgac ccgccttcac       240
     cttttgcgct tggctggcct tccagcatct ttggtcgcgt ggtgtttgat tcaaaaacac       300
     agacctgatc tggtcttggc tgaatttggc tttgaagcag tacgtgtgat ggaagccgcg       360
     gtttgggcca aggtccctct tgtggcgcat ttccgaggat cggatgcttc agctcatgat       420
     cgccttggtc ttttagaagg tcgatatcgc cgtttgcttg gtgtggtttc tggagtgatc       480
     gtgaagtcca gaccgatggc acaaactatg gagcgattag gtgctgatcc cgctcatatt       540
     ttgatcagtc catctggtgc taacgcacag ttgttcagag gtggcaatcc agcaatagct       600
     ccacctgtgc tacttgcggt ggggaggttc gtagccaaaa agggcccttt acagacagtg       660
     cgtgcgtttg ggcggtgcag tgagcaaggc ggaaccgcga tgaagacagc cgaattgtgg       720
     atggttgggg atggaccgtt gctagttgcg gcccaggctc tggtgattca gctcggctta       780
     cagaatcgag tgcgcttctt agggcctaag ccaccggtag ctgtagctgc tttaatgcga       840
     gaggtacgtg ctttcgtcca gcattcctgc gtggcccctg atggagacag tgaagggagc       900
     cccgtatcag taatggaagc tcagctcagc ggccttcctg tgatttccac gtttcacgca       960
     ggaatcccag aggtggtgat cgatcagacc actggcctcc ttgtgcaaga aggtgatgag      1020
     cgggccatgg ctgactgcat gatcgaattg cttcttgatc catccagagc tgaggccctt      1080
     gggaatgcgg gcaggaatcg ggtattgcgt cactacacca ttgatcatca tctgcgtgat      1140
     gtcactgctt ttttgcgtgc cagaatgcca atgtctttcg taggacaaga gttgattaag      1200
     catgtttag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page