(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE223

CP000435.PE223       Location/Qualifiers
FT   CDS_pept        234569..235435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0226"
FT                   /product="conserved hypothetical"
FT                   /note="identified by match to protein family HMM PF00685"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47258"
FT                   /db_xref="GOA:Q0IDL0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL0"
FT                   /protein_id="ABI47258.1"
FT                   /translation="MACLLLKDMRENGPHFIVIGAQRSGTTWLHRVMTQHDQLWLTPVK
FT                   ELHYFDKQELRLGVMSAYERNRARFWSPRRLMLDPRWYCRYWFLPRSDEWYGKLFRRAR
FT                   QKGKITGEITPAYAVLPEKEWDHLYSLFPDVRLVFIMRDPIIRTWSALRNNMKKGRLNS
FT                   ASSVDELVAQASGFSMASRSDYLRTIKTVESRFGADRVHCCFFEQLLSDPTELADSLFQ
FT                   FLGAKPMGEALNIPPAVNSAAGGDAPPFALQQALAEQYLPMVDELAERFGEVPLSWANR
FT                   YRNLLGV"
     ttggcatgtc tcttgttgaa agacatgcgt gaaaatggac ctcacttcat cgtgatcggt        60
     gcccagcgct ctggtaccac ttggctgcat cgtgtaatga cacaacatga tcagctttgg       120
     ttgaccccgg taaaagaact gcattatttc gacaagcaag aactacggtt aggcgtaatg       180
     agtgcctatg agaggaatag ggcgcgtttt tggagcccac gtcgtttaat gctagatcca       240
     cgatggtatt gccgatactg gtttcttcct cgtagtgatg aatggtatgg aaaattattt       300
     cgtcgtgccc gtcaaaaagg aaaaataaca ggagaaatta ctcctgccta tgcagtcttg       360
     ccagagaaag aatgggatca tttgtactct cttttccctg atgttcgttt ggtttttatt       420
     atgcgtgatc cgatcatacg aacttggtct gctttgcgca acaatatgaa aaagggtcgt       480
     ttgaattctg cttcatctgt ggatgaatta gttgcgcagg cttcaggctt ctcgatggca       540
     tctcgttctg actatttgcg gacgattaaa actgtggagt ctcgattcgg tgcagatcga       600
     gtgcattgtt gtttctttga gcagctttta agcgatccta cggaattggc tgactccctc       660
     tttcagttct tgggagcaaa gcctatggga gaggctctca acattccccc tgctgtcaat       720
     agtgctgctg gaggcgatgc tccaccattt gcgcttcaac aagctttggc agagcaatac       780
     ttgccaatgg tcgatgaatt agctgaacgt tttggggagg ttcccctgag ttgggccaat       840
     agataccgta atttgctggg agtataa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page