(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE227

CP000435.PE227       Location/Qualifiers
FT   CDS_pept        complement(241055..243181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0230"
FT                   /product="Selenide,water dikinase"
FT                   /note="identified by match to protein family HMM PF02769"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47403"
FT                   /db_xref="GOA:Q0IDK6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK6"
FT                   /protein_id="ABI47403.1"
FT                   /translation="MNPGSRPNTFITLVSRHSTALYSGMVPGLVAGLYQREELEIDLRQ
FT                   LTDQAEVALIVAEIKGLDPAKHKLWLADRPPIGYDQLSLNVGCITNNLGPIQQDTLAIK
FT                   PLEQALTAIDEADANSLTAPVRILGSGLAAIEVSLALRHRWPSRTLSLQARTDSIHPPF
FT                   QRGLALAGVSVQPASTPGGRTKPSLQGKKSLDLNCTGSCAPTWLKDSGLPVDERGRVRT
FT                   EATLEVLGHSGHFAAGDCAVIDADPRPASGVWAVRAAGPLSRNLKASCNNRPLRPWRSQ
FT                   RHAMQLVGGFSINGEPTAWALWGPICLGPHALLWKWKEHIDRRFMSRLQGTHMAEENHD
FT                   SQGAMLCRGCAAKFPADDLEAALEEAGFAKLGNTPEDAASIPETQSTDGDPVLQSVDGF
FT                   PALISDPWLNARLTALHACSDLWACGARVRSAQAVVTLPQAAQSLQRLLLSQTLAGLRS
FT                   ALEAQGAELIGGHTLESRSHTEGTLSLGVQVALNVQGSAQGPIWNKRGIQAGDQLLLSG
FT                   SLGMGVLFAAAMKGAVRPGELDKALAQMNRSQHRLVDLLRNLEKEHPGQLHAATDITGF
FT                   GLLGHLGEMLGDAPEVTAQPQVILDAEKIPALPGALELLSAGHSSSLAPANRRAFALLH
FT                   PKAQLSGHALVTLTMGQKTKNSRSSRALLDLLVDPQTCGPLLISIAPEMAKALLAQAPD
FT                   EWRSIGRAFSHSRN"
     atgaaccctg gcagcagacc aaacactttc atcaccctgg tcagtcggca tagcaccgct        60
     ctttattcag gaatggttcc aggacttgta gcaggccttt accagcgcga agaactggag       120
     atcgatctga gacagctgac ggatcaggcc gaagttgctc tcatcgtcgc ggagatcaaa       180
     gggcttgatc ccgcaaaaca caaactctgg ttagctgatc gaccgccaat tggatacgac       240
     cagctcagcc tcaacgtggg ctgcatcacc aacaaccttg gccctatcca acaagacacc       300
     ctcgcgatta aaccgctgga acaggccctc accgcgatcg atgaggccga cgcgaattca       360
     ctgaccgctc cagtacgaat tctgggttca ggcctagcgg caatcgaagt gagccttgct       420
     ctacgccatc gctggcccag ccgaacgttg agcctccaag cacgaacgga ctccattcac       480
     ccaccatttc aaagaggctt agcccttgca ggggtatcgg tgcaaccagc ctctacccct       540
     ggagggagga ccaaaccctc cctccaggga aagaaaagcc tcgatctgaa ctgcactggt       600
     agctgtgcac ccacctggtt gaaagacagc gggttaccag tcgacgagcg agggagagtg       660
     cgaacagaag ccactctgga agtgctgggc cattcaggcc atttcgcggc aggagactgc       720
     gctgtgatcg acgccgaccc acgacccgct tccggcgtct gggctgtacg agccgctggg       780
     cccttgtcac gcaacctcaa ggccagctgc aacaacaggc cattacgtcc ctggcgctcc       840
     cagcgtcatg ccatgcagtt agtaggcggt ttcagcatca acggggaacc aacagcatgg       900
     gccctctggg gtccgatctg cctaggcccc cacgccttgc tgtggaaatg gaaagagcac       960
     attgaccgcc ggtttatgtc ccgattgcaa gggacgcata tggctgaaga aaaccacgat      1020
     tcgcaaggcg ccatgctttg ccggggctgt gccgcaaaat ttcccgcaga tgatctagaa      1080
     gcagccctcg aggaagccgg attcgccaag cttggcaata caccagagga tgccgcatcc      1140
     ataccagaga cccaaagcac agatggcgat cccgttttgc aaagcgtgga tggtttccca      1200
     gcactgatca gtgatccatg gcttaatgcc aggcttacgg ctctgcacgc ctgttccgac      1260
     ctctgggcgt gtggcgcaag agtgcgctca gcccaagccg tggtcactct gccgcaagcg      1320
     gctcaatcgt tgcaacgact gttgctcagc caaactcttg ccggcctgag atcggcgctt      1380
     gaggcccaag gcgcagagct gatcggcggc cacaccctgg aatcacgcag ccataccgag      1440
     gggacattga gcctaggggt tcaggtggct ttgaacgtgc agggttcagc gcaaggtccg      1500
     atttggaaca agcgcggaat acaagccggc gaccagttgt tactcagcgg ttcacttggt      1560
     atgggcgtgc tcttcgctgc agccatgaaa ggggccgtgc ggccaggtga acttgacaag      1620
     gcactggcac aaatgaatag gagccaacat cggctagttg atctacttag gaatcttgag      1680
     aaagagcacc ctggtcaact ccatgccgca actgatatca ctggatttgg gcttttaggc      1740
     cacctaggcg agatgctcgg ggacgctccc gaagtcacag cacagcctca agtcattttg      1800
     gacgcggaaa aaatcccagc cttaccagga gccctagaac tattgagtgc aggccactcg      1860
     agcagccttg ctccagcaaa taggcgagcc ttcgcattgc tgcatcccaa ggcgcagctc      1920
     tcagggcatg ccttggtaac gctgacgatg ggccaaaaaa ccaagaacag cagatctagc      1980
     agagcattgc tggatctatt agttgatccc caaacatgcg gaccacttct gatcagcatc      2040
     gctccagaaa tggccaaagc actcctggcc caggccccag acgagtggcg gtcgattggc      2100
     agagcatttt ctcattcaag aaactaa                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page