(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE23

CP000435.PE23        Location/Qualifiers
FT   CDS_pept        29298..30353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0023"
FT                   /product="DnaJ protein"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47537"
FT                   /db_xref="GOA:Q0IE60"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE60"
FT                   /protein_id="ABI47537.1"
FT                   /translation="MARQYHPDINKEAGAEDRFKEIGRAYEVLSDPQTRGRYDQFGEAG
FT                   LGGGGGMPDMGDMGGFADIFETFFSGFGGAAGGAGRQRRRGPQQGDDLRYDLTIDFDQA
FT                   VFGQEREIRIPHLETCTTCGGSGAKSGSGPTTCTTCGGVGQVRRATRTPFGNFEQVAEC
FT                   PSCNGSGQVIADPCSSCGGQGVTQVRKKLRINIPAGVDTGTRLRVSGEGNAGLRGGPSG
FT                   DLYVFLTVKSHPSLRRDGLTVLSEVKVSYLQAILGDTIEVETVDGPESLDIPAGTQPNS
FT                   VLSLENKGIPKLGNPVARGHQRISVTVTLPTRLNDEERGLLEDLAGHHSARGEQHHHHK
FT                   SGLFARLFGQR"
     atggctcgcc aatatcaccc tgatatcaat aaagaggctg gagctgaaga tcgcttcaag        60
     gagattggcc gcgcctacga ggtgctgagc gatccccaaa cccgcgggag gtatgaccag       120
     ttcggtgagg ctgggctcgg tggcggcggt ggcatgcccg atatgggcga tatgggtggt       180
     ttcgcagaca ttttcgaaac ctttttcagt gggtttggtg gtgctgctgg tggtgcaggt       240
     cgtcagcgca ggcgagggcc tcaacaggga gatgacctgc gctacgacct cacgattgat       300
     tttgaccagg ctgtctttgg tcaagagcgg gagattcgca tcccccacct cgagacctgc       360
     accacctgtg gcgggagcgg tgccaaatcg gggagtggtc ccactacctg tactacctgt       420
     ggtggagttg ggcaggtgcg tcgcgctacg cggactccct ttgggaattt tgagcaggtg       480
     gctgaatgcc ccagttgcaa tggcagtggc caggtgattg ctgacccttg cagttcctgc       540
     gggggtcaag gggtcacgca ggtccgtaag aaattgcgaa tcaacattcc cgctggtgtt       600
     gacacgggca cccgcctgcg ggtttccggt gagggaaatg ctgggctacg tggcggtcct       660
     tctggagatt tatatgtatt tctcacggtt aaatcacatc caagcctgag gcgcgatggg       720
     ctcaccgtcc tttcggaggt gaaggtgagt tatctgcagg caatccttgg cgacaccatt       780
     gaggtggaaa cagtggatgg acccgaatcg ctggacattc cggcaggaac ccagcccaat       840
     tccgtgttat cgcttgaaaa caaaggtatc cccaagctgg gaaatccagt ggcccgtggt       900
     catcagcgca tttccgtcac ggtgacattg ccgacccgtc tcaacgatga agaacgcggt       960
     ctcctcgaag atttggctgg acaccattca gcccgtggtg agcagcacca tcaccacaag      1020
     agtggcctat ttgctcgact cttcgggcaa cgctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page