(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE230

CP000435.PE230       Location/Qualifiers
FT   CDS_pept        245770..247209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0233"
FT                   /product="UDP-glucose dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46864"
FT                   /db_xref="GOA:Q0IDK3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK3"
FT                   /protein_id="ABI46864.1"
FT                   /translation="MSSNPTIQSICCIGAGYVGGPTMAVIADRCPDVKVTVVDINQDRI
FT                   AAWNNGDLSKLPVYEPGLDAVVERARGRNLFFSTAVEETIASADMVFISVNTPTKTKGL
FT                   GAGQASDLRWVEACARTVAKAAQGYTIVVEKSTLPVRTAEAVKAILGSVDPSSELKTFS
FT                   VLSNPEFLAEGTAIRDLASPDRVLIGGDNAEAIDALAEIYQQWVPEEKILRTNLWSSEL
FT                   SKLTANAFLAQRISSINSVAALCEATGADVREVAKAIGTDSRIGPKFLSAGPGFGGSCF
FT                   QKDILNLVYLCRHFGLPDVADYWESVVLLNTWQQHRIARLVVQKLFGTVTGKRLAILGF
FT                   AFKADTNDTREAPAIRICRDLLEEGAQLAIHDPKVDPEQISRDLKLIASHAPEADAGPT
FT                   RGALSGEATWWPSPDVASALRGADAVLILTEWKQYRELDWAALAPLMRKPAWLFDARGV
FT                   ADPKQVASAGLNVWRVGEGDA"
     atgagcagca atcccacgat tcaatcgatt tgctgtatcg gtgctggcta tgtaggcggt        60
     cccaccatgg ctgtgatcgc cgatcgctgt ccggatgtga aggtcacggt tgtggacatc       120
     aatcaggatc ggattgctgc ctggaacaac ggcgatctct ccaagttgcc tgtgtatgaa       180
     ccaggcctgg atgcggtggt ggagcgggcc cgcgggcgca atttattttt ctccacggct       240
     gtggaggaaa cgattgcgtc tgcggacatg gtgttcatct ccgtaaacac acccaccaag       300
     accaagggcc tgggtgctgg gcaggccagt gatcttcgct gggtggaagc ctgcgcgcga       360
     acggtggcga aggccgctca gggctacacg atcgtggtgg agaaaagtac ccttccggtt       420
     cgaacggcgg aagccgtcaa ggcgattttg gggtccgttg atccatcgtc ggagctgaaa       480
     actttttcgg tgctttccaa tcctgagttt ttggctgagg ggacggcgat tcgcgatctt       540
     gcaagcccag atcgcgtctt gatcggtggg gataatgccg aagcgatcga tgctttggca       600
     gagatttatc aacagtgggt gcctgaagag aagattcttc gcaccaattt gtggagcagc       660
     gagttgtcca agctcaccgc taacgcgttt cttgcgcaga gaattagctc gatcaactcc       720
     gttgcggctc tgtgtgaagc caccggtgcg gatgtgcgcg aggtggcgaa ggcgatcggc       780
     accgatagcc ggattggacc caaatttctg agtgcaggcc ctggttttgg gggtagttgt       840
     ttccagaaag atatcctcaa tttggtgtat ctctgtcgtc acttcggttt gccagatgtg       900
     gccgactatt gggagagtgt ggtgttgctg aacacctggc aacagcaccg catcgcccgc       960
     ttggtggttc agaaattgtt tggcacggtc acgggcaagc gactggccat tttgggcttt      1020
     gcgtttaagg cggacaccaa cgacacgcgc gaggctccag cgattcgaat ttgcagagat      1080
     cttcttgaag aaggcgctca gctggccatt catgatccaa aggtggatcc ggaacagatc      1140
     agccgcgatt taaaactgat tgcgagccac gcaccggagg cggatgccgg gccaactcgg      1200
     ggtgccttga gtggagaagc cacctggtgg cccagccccg atgtggcctc agcgctgcgg      1260
     ggtgccgatg ccgtcctgat cctcacggag tggaagcagt atcgggagct ggattgggcc      1320
     gcacttgcgc cgttgatgcg caaaccggct tggttgtttg atgcccgtgg cgtcgctgac      1380
     ccgaaacaag ttgcctccgc tggtcttaac gtttggcgcg ttggcgaggg tgacgcgtga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page