(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE238

CP000435.PE238       Location/Qualifiers
FT   CDS_pept        complement(250789..251229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0241"
FT                   /product="Rubredoxin"
FT                   /note="identified by match to protein family HMM PF00301"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47048"
FT                   /db_xref="GOA:Q0IDJ5"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ5"
FT                   /protein_id="ABI47048.1"
FT                   /translation="MSDEISPAAEVPADVDPLAEELIEAEPNQDEASTSTDKETTDPRT
FT                   HRFECRSCGYVYDPDEGVKKLGIVVGTAFEDLDPIRFRCPVCRSRVGAFTDIGPRSKAS
FT                   GFEENLNFGLGVNRLTPGQKNVLIFGGLALGFAFFLSLYSLR"
     gtgagcgacg agatcagccc agcagcggaa gttcccgccg acgttgaccc cctcgcagag        60
     gagttaatcg aagcagaacc caatcaagac gaagcaagca ccagtacaga caaggagaca       120
     accgatccac gcacgcatcg gttcgaatgt cgaagctgtg gatacgttta cgaccccgat       180
     gagggtgtca aaaagctggg catcgttgtg ggcaccgctt ttgaagatct cgaccccatc       240
     agattccgtt gtccggtctg ccgcagcagg gttggagcct ttaccgacat tggccctcga       300
     tccaaagcga gtggatttga ggagaacctt aatttcggtc tcggcgttaa ccgcctcact       360
     ccagggcaaa aaaatgtgct gatttttggc ggcctcgccc ttggctttgc tttcttcctc       420
     tccctttatt cactgcgctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page