(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE239

CP000435.PE239       Location/Qualifiers
FT   CDS_pept        251264..251692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0242"
FT                   /product="NADH dehydrogenase I chain 3 (or A)"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by match to protein family HMM PF00507"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47507"
FT                   /db_xref="GOA:Q0IDJ4"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDJ4"
FT                   /protein_id="ABI47507.1"
FT                   /translation="MGLATTEVVYECQTGVQIEAALMFVLPGYDAFLGFLLIAAAVPVL
FT                   ALVTNKLLAPRSQTGERELTYESGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPW
FT                   AVAFHRLGLLAFIEALVFITILLVALAYAWRKGALEWS"
     ttgggccttg caacgacaga ggtggtctac gaatgccaga ctggggtcca gatcgaggct        60
     gccttgatgt ttgtgctgcc gggttatgac gcatttctgg gatttctgct gattgcagca       120
     gcagtaccgg ttttggcgtt ggtaaccaac aagcttctgg ctcctcgcag tcagaccgga       180
     gagcgtgagc tcacctatga atccgggatg gagccgatcg gtggagcttg gattcaattc       240
     aatattcgct attacatgtt cgcgcttgtc ttcgtcattt ttgatgtgga gacggtcttc       300
     ctttatccct gggctgttgc cttccatcgc ttgggcttac tggctttcat cgaagccctt       360
     gtgtttatta ccatcctgct tgtggcattg gcctatgcat ggcgtaaagg cgccctcgag       420
     tggagctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page